DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chsy and Csgalnact2

DIOPT Version :10

Sequence 1:NP_996440.2 Gene:Chsy / 32497 FlyBaseID:FBgn0030662 Length:832 Species:Drosophila melanogaster
Sequence 2:NP_084441.3 Gene:Csgalnact2 / 78752 MGIID:1926002 Length:542 Species:Mus musculus


Alignment Length:52 Identity:14/52 - (26%)
Similarity:21/52 - (40%) Gaps:16/52 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRNLSVI--------------VFFFTSFVILVSCYNVPPTGIPAVSEVDTMI 38
            |::|.||              |..|.|.|:||.|:..  .||..:.:|...:
Mouse   645 MQDLGVISTISLSWFLTLFLSVMPFDSAVLLVDCFFY--EGIKVIFQVSLAV 694

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ChsyNP_996440.2 Galactosyl_T 71..>251 CDD:473923
CHGN 221..801 CDD:461712
Csgalnact2NP_084441.3 CHGN 75..516 CDD:461712
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.