DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9220 and b4galnt4a

DIOPT Version :9

Sequence 1:NP_001285280.1 Gene:CG9220 / 32497 FlyBaseID:FBgn0030662 Length:832 Species:Drosophila melanogaster
Sequence 2:XP_001920875.4 Gene:b4galnt4a / 565184 ZFINID:ZDB-GENE-100422-4 Length:1172 Species:Danio rerio


Alignment Length:635 Identity:126/635 - (19%)
Similarity:238/635 - (37%) Gaps:141/635 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 RADDDVYMEPDKLERFLRSIDSSKPQ------FIGQAGKGNSEEFGLLSLEFDENFCMGGPGVIL 210
            :.|:.:|:...:..|..:.:.|..|:      |:.|.||...    |::|......   |.|.:.
Zfish   608 KEDNKIYVTRPRPAREKQGLVSRHPREVFPGVFLYQNGKTTK----LVNLSAKPKL---GKGPLR 665

  Fly   211 SSETLRR-------VAPHIPSCLKNLYSTHEDVEVGRCVQKFAGIPCTWNYEMQYILRHNSSGRN 268
            :|:...|       |.|..|: ..|....:.........::..|:   |.       :|....|.
Zfish   666 ASQLFARSPLQESKVFPASPN-FSNPIPPNRAAIPSHFERRIRGV---WE-------KHQHPLRP 719

  Fly   269 AYTGKLKRKEIHNAITLHPIKQAPLMYRLHSYVQGLKAEEMRQESLLLHRDIKRMAKYLEVPDES 333
            ..|.:...:..:::..:.|.:..    |:.||:...:..|.:|:.                ||  
Zfish   720 VTTLRPTPQSSNSSENVPPTESV----RVTSYMHTSQITESQQQR----------------PD-- 762

  Fly   334 TYMLPSVSPESDS--TKRHFQDHNILGISPELNKFVPASTDDLLDW--SFIARSLYSASSANPKQ 394
                ..:.||.|.  ::..::|     :.|.     |...::.::|  :|...|:...|..:...
Zfish   763 ----TDLEPEEDGGLSEYSYED-----VEPR-----PGWAEEAINWQRTFSVNSMDFESLRSDWN 813

  Fly   395 KIDSAMREGLE-------DAITEVMENINNYSRQRGRVIEFRELLYGYHRLDALHGQDMILDLLL 452
            .:...:...|:       |.:.:.||.:|   .:.|.:.....::....|.|:..|...:::|.|
Zfish   814 DLRCNVSGNLQLSESEVVDVLAQYMEKLN---ERNGGIYTLLRIINVEKRRDSARGNRYLVELEL 875

  Fly   453 IYKKYRGKKMTVPVRRHLYV----QRA------FTGIFVKEVDEDFYNVTLQQSLLGSLFQNGMA 507
            :   .||:|: |.:..::|:    .||      ..|:..........:...|.|...:....|..
Zfish   876 M---ERGRKI-VRLSEYIYMLLHRGRAEDSLENVEGVTASSPSSPVASPPAQPSHTPTRGARGTP 936

  Fly   508 RLSSHFTMPSGLLSPT-----QDKIV-FVLPIAGRLGTFERFLRTYERV-CVRGEQHCDLLVVIF 565
            :..:.:..|. |..|.     :|.:| ||:|:..:....::|:...|.: ....:.:.::::|.|
Zfish   937 QWGTVYAKPL-LCQPVMLRWKKDVMVHFVVPVKNQARWVQQFISDMESLHSETKDNNFNIIIVDF 1000

  Fly   566 GSPDELGDHLQLLHDLHARHVYQQVNWIQRSSAFSRGVALDVAARSSYIRQEDIILFI-DVDMVF 629
            .|.|.  |..|.|.:    ....:..:::|...|.|...|.:...:  |.....|:|: |:.:.|
Zfish  1001 QSEDM--DVEQALRE----STVPRYEYLRREGNFERSAGLQIGVDT--IEDSHSIVFLCDLHIHF 1057

  Fly   630 EVETLQRVRMHTQRGKQVYLPIVFSQYDPQRRSGDAGGSEDEGETPRIDDERGYFRQFGFGICAI 694
            ....|:.:|.|...||..:.|||.       |.|.       |.:|...|  ||:...|||:..|
Zfish  1058 PPNILENIRKHCVEGKLAFAPIVM-------RLGC-------GSSPLEPD--GYWEVNGFGLFGI 1106

  Fly   695 YKSDILDEDINGFD----KDITGWGLEDVKFLEKIVRVG-----TRQRGF 735
            ||||.  :.|.|.:    ||  .||.||.:.|:::::.|     .|.|.|
Zfish  1107 YKSDF--DKIGGMNTEEFKD--RWGGEDWELLDRVLQNGLEVERLRLRNF 1152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9220NP_001285280.1 Galactosyl_T 71..>251 CDD:304462 20/111 (18%)
CHGN 221..799 CDD:283361 109/553 (20%)
b4galnt4aXP_001920875.4 PA14 145..279 CDD:324285
Glyco_tranf_GTA_type <830..1157 CDD:325014 83/359 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3588
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.