DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9220 and Csgalnact2

DIOPT Version :9

Sequence 1:NP_001285280.1 Gene:CG9220 / 32497 FlyBaseID:FBgn0030662 Length:832 Species:Drosophila melanogaster
Sequence 2:NP_001100086.1 Gene:Csgalnact2 / 297554 RGDID:1563660 Length:542 Species:Rattus norvegicus


Alignment Length:631 Identity:143/631 - (22%)
Similarity:235/631 - (37%) Gaps:183/631 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 NYEMQYILRHNSSGRNAYTGKLKRKEIHNAITLHPIKQ--APLMYRLHSYVQGLKAEEMRQE--- 312
            |..:..::|.| .|:..|...|:.:|.|.......:|:  |.|...|....:.::|.:.|::   
  Rat    41 NASLPGVVREN-YGKEYYQALLQEQEEHYQTRATSLKRQIAQLKQELQDMSEKMRALQERKKLGA 104

  Fly   313 --------------SLL--LHRDIKRM---------AKYLEVPDESTYMLPSVSPESDSTKRHFQ 352
                          .||  ||..|.|.         ::|..||.||..::.....|...| ||  
  Rat   105 NGIGYQGNREQTPSDLLEFLHSQIDRAEVSIGAKLPSEYGVVPFESFTLMKVFQLEMGLT-RH-- 166

  Fly   353 DHNILGISPELNKFVPASTDDLLDWSFIARSLYSASSANPKQKIDSAMREGLEDAITEV----ME 413
                                                   |::|   .:|:...|.:.||    :|
  Rat   167 ---------------------------------------PEEK---PVRKDKRDELVEVIEAGLE 189

  Fly   414 NINNYSRQ---------RGRVIEFRE--LLYGYHRLDALHGQDMILDLLLIYKKYRGKKMTVPVR 467
            .|||....         .|..:.|.|  .:.||:|.:...|....|..         ||..:...
  Rat   190 VINNPDEDDEQEDEEGPLGEKLIFNENDFIEGYYRTERDKGTHYELFF---------KKADLMEY 245

  Fly   468 RHLYVQRAFTGIFVKEVDEDFYNVTLQQSLLGSLFQNGMARLSSHFTMPSGLLSPTQDKIVFVLP 532
            ||:.:.|.|                      |.|.:           :.|.|:..|:..|..::|
  Rat   246 RHVTLFRPF----------------------GPLMK-----------VKSELIDITRSVINIIVP 277

  Fly   533 IAGRLGTFERFLRTYERVCVRGEQHCDLLVVIFGSPDELGDHLQLLHDLHARHVYQQVNWIQRSS 597
            :|.|...|.:|::.:..||:..::...|.||.||. :.|.....:|..:.:...:.....:..:.
  Rat   278 LAERTEAFSQFMQNFRDVCIHQDKRIHLTVVYFGK-EGLSTVKSILESVSSESNFHNYTLVSLNE 341

  Fly   598 AFSRGVALDVAARSSYIRQEDIILFIDVDMVFEVETLQRVRMHTQRGKQVYLPIVFSQYDPQRRS 662
            .|:||..|:|.|| ::.:.|.::.|.|||:.|..|.|...|::.:.||:|:.|:|||.|:|    
  Rat   342 EFNRGRGLNVGAR-TWDKGEVLMFFCDVDIYFSAEFLNSCRLNAEPGKKVFYPVVFSLYNP---- 401

  Fly   663 GDAGGSEDEGETPRIDD------ERGYFRQFGFGICAIYKSDILDEDINGFDKDITGWGLEDVKF 721
              |....::...|.::.      :.|::|.||||:...|:||.|  .:.|||.::.|||.|||..
  Rat   402 --AIVYANQEVPPPVEQQLVHKKDSGFWRDFGFGMTCQYQSDFL--SVGGFDMEVKGWGGEDVHL 462

  Fly   722 LEKIVRVGTRQRGFLANTAELAMDYNEAAEQWRRLSVFRAPDPTLVHIYHDISCDVQLDAPQYNM 786
            ..|.:.                          ..|.|.|.|.|.|.|::|:..|..:|...||.|
  Rat   463 YRKYLH--------------------------GDLIVIRTPVPGLFHLWHEKHCADELTPEQYRM 501

  Fly   787 CLGTKA-NSLGSTRLMEQLFHSSPENVQFAADFNRQKQQQQQQQQA 831
            |:.:|| |....:.|...:|....|       .:.:||..:...:|
  Rat   502 CIQSKAMNEASHSHLGMMVFREEIE-------MHLRKQAYRTNSEA 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9220NP_001285280.1 Galactosyl_T 71..>251 CDD:304462
CHGN 221..799 CDD:283361 137/597 (23%)
Csgalnact2NP_001100086.1 Glyco_tranf_GTA_type 67..516 CDD:299700 130/571 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3588
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.