DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9220 and B4GALNT3

DIOPT Version :9

Sequence 1:NP_001285280.1 Gene:CG9220 / 32497 FlyBaseID:FBgn0030662 Length:832 Species:Drosophila melanogaster
Sequence 2:NP_775864.3 Gene:B4GALNT3 / 283358 HGNCID:24137 Length:998 Species:Homo sapiens


Alignment Length:396 Identity:94/396 - (23%)
Similarity:174/396 - (43%) Gaps:75/396 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   362 ELNKFVPASTDDLLDW--SFIARSL--------YSASSANPKQKIDSAMREGLEDAITEV-MENI 415
            |:.::||. .|.:::|  :|.||:|        :...|.|....:....:|.||  :|.| ::.:
Human   620 EVFEYVPV-FDPVVNWDQTFSARNLDFQALRTDWIDLSCNTSGNLLLPEQEALE--VTRVFLKKL 681

  Fly   416 NNYSRQRGRVIEFRELLYGYHRLDALHGQDMILDLLLIYKKYRGKKMTVPVRRHLYVQ-RAFTGI 479
            |  .|.||| .:.:.::....|.|.|.|...:|:|.|:   .:|:::   ||...||. |.:.||
Human   682 N--QRSRGR-YQLQRIVNVEKRQDQLRGGRYLLELELL---EQGQRV---VRLSEYVSARGWQGI 737

  Fly   480 FV---KEVDEDFYNVTLQQSLLGSLFQ---------NGMARLSSHFTMPSGLLSPTQDKIVFVLP 532
            ..   :||:        .::|.|.::.         |..|: ......|.|.....:..:.||:|
Human   738 DPAGGEEVE--------ARNLQGLVWDPHNRRRQVLNTRAQ-EPKLCWPQGFSWSHRAVVHFVVP 793

  Fly   533 IAGRLGTFERFLRTYERVC-VRGEQHCDLLVVIFGSPDELGDHLQLLHDLHARHVYQQVNWIQRS 596
            :..:....::|::..|.:. |.|:.|.::::..:.|.| :...:.|     .|...:...:::.|
Human   794 VKNQARWVQQFIKDMENLFQVTGDPHFNIVITDYSSED-MDVEMAL-----KRSKLRSYQYVKLS 852

  Fly   597 SAFSRGVALDVAARSSYIRQEDIILFI-DVDMVFEVETLQRVRMHTQRGKQVYLPIVFSQYDPQR 660
            ..|.|...|.  |....::....|:|: |:.:.|....:..:|.|...||..:.|:|...:.   
Human   853 GNFERSAGLQ--AGIDLVKDPHSIIFLCDLHIHFPAGVIDAIRKHCVEGKMAFAPMVMRLHC--- 912

  Fly   661 RSGDAGGSEDEGETPRIDDERGYFRQFGFGICAIYKSDILDEDINGFD-KDITG-WGLEDVKFLE 723
                       |.||:..:  ||:...|||:..|||||:  :.|.|.: |:... ||.||.:.|:
Human   913 -----------GATPQWPE--GYWEVNGFGLLGIYKSDL--DRIGGMNTKEFRDRWGGEDWELLD 962

  Fly   724 KIVRVG 729
            :|::.|
Human   963 RILQAG 968

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9220NP_001285280.1 Galactosyl_T 71..>251 CDD:304462
CHGN 221..799 CDD:283361 94/396 (24%)
B4GALNT3NP_775864.3 PA14 143..277 CDD:284994
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 302..326
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 486..562
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 597..616
Glyco_tranf_GTA_type <788..984 CDD:299700 50/207 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3588
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.