DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9220 and C17A2.3

DIOPT Version :9

Sequence 1:NP_001285280.1 Gene:CG9220 / 32497 FlyBaseID:FBgn0030662 Length:832 Species:Drosophila melanogaster
Sequence 2:NP_494669.1 Gene:C17A2.3 / 182699 WormBaseID:WBGene00015871 Length:348 Species:Caenorhabditis elegans


Alignment Length:194 Identity:49/194 - (25%)
Similarity:82/194 - (42%) Gaps:38/194 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 VFVGVMTAKSFLEGRARAVYDTWGKEVP----GRMAFFSSEGSYSDDLPVVGLKNVDDRYPPQ-K 130
            :|..|.|:..:.:.|..:|..||   :|    ||. |..:...|.|.......:|:.|.|... :
 Worm   102 IFCFVETSTKYYKDRVPSVASTW---LPRCDHGRF-FTKTHLPYPDIAYSTVYRNLRDTYDDLFR 162

  Fly   131 KSFMMLYYMYEHYIDRFEWFIRADDDVYMEPDKLERFLRSIDSSKPQFIGQAGKGNSEEFGLLSL 195
            ||...|||.|......|:|:::.|||.::..|.|..:|.:::.::|.::|..          |:.
 Worm   163 KSIFSLYYSYTSISKHFDWYLKTDDDTFVAMDHLREYLNTLNPAEPLYLGYR----------LAP 217

  Fly   196 EFDENFCMGGPGVILSSETLR----------RVAPHIPSCLKNLYSTHEDVEVGRCVQKFAGIP 249
            ..:..:..||.|.|||:..:|          |:.|         |...||..:|||::.....|
 Worm   218 FMNNGYNSGGSGYILSNAAMRMFVEQLYHNVRLCP---------YDRGEDRGMGRCLESVGITP 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9220NP_001285280.1 Galactosyl_T 71..>251 CDD:304462 49/194 (25%)
CHGN 221..799 CDD:283361 7/29 (24%)
C17A2.3NP_494669.1 Galactosyl_T 98..>239 CDD:304462 39/150 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.938488 Normalized mean entropy S4160
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.