DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8097 and Dalrd3

DIOPT Version :9

Sequence 1:NP_001285279.1 Gene:CG8097 / 32495 FlyBaseID:FBgn0030660 Length:446 Species:Drosophila melanogaster
Sequence 2:XP_011241203.1 Gene:Dalrd3 / 67789 MGIID:1915039 Length:545 Species:Mus musculus


Alignment Length:231 Identity:52/231 - (22%)
Similarity:94/231 - (40%) Gaps:34/231 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 CVTVELEKC---------------CNGKQPVEHVCLTCGPVLEPINKGASSLTVDEYLKLR-CQH 251
            ||.:.:..|               .:.:.|.:...|.|||| :......:.||..:|.:|| .|.
Mouse   275 CVVIHVVSCEEAFQQQKLDLLWQKLDDRAPHKQKHLVCGPV-KMAGVPGTQLTAPQYYRLRHAQV 338

  Fly   252 MELMATQRSG---MCPVPMSSLDTLTKRLAAAAVIVDLFVVRHSSAVSVVRNGVGI--CKGASYI 311
            .|..|.:..|   ..|....:.|.    |:.|.:..::......|.:.:..:.:..  .|..:::
Mouse   339 CEASALKHGGDLAQDPAWTETFDI----LSVATIKFEMLSTAPQSQLLLAHSTISTKGTKSGTFV 399

  Fly   312 LYNSARLEALLRKFNYEVNNCAYEKLPLLDEIDLSVLEDDVDWELIYGYLLTFPELMESIMDQLD 376
            :||.|||..|...:.:......|...||:..:|.|:|.|:.:|.|::..:|.|.:|:...:..  
Mouse   400 MYNCARLATLFEGYKHGTEQGLYPTFPLVSSLDFSLLHDEGEWLLLFNSVLPFLDLLSQTVSL-- 462

  Fly   377 QGHCGLHLLVH------YVENLAAAFSRFYYHKKVL 406
            .|..|||:.|.      ::..|:..||.:|....:|
Mouse   463 AGTPGLHIPVRTEMVCKFLVQLSMDFSSYYNRVHIL 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8097NP_001285279.1 DALR_1 311..445 CDD:214846 28/102 (27%)
Dalrd3XP_011241203.1 DALR_1 399..>499 CDD:214846 28/102 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836371
Domainoid 1 1.000 79 1.000 Domainoid score I8682
eggNOG 1 0.900 - - E1_COG0018
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8236
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008240
OrthoInspector 1 1.000 - - oto95427
orthoMCL 1 0.900 - - OOG6_107731
Panther 1 1.100 - - LDO PTHR16043
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5723
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.680

Return to query results.
Submit another query.