DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8097 and RARS1

DIOPT Version :10

Sequence 1:NP_573046.1 Gene:CG8097 / 32495 FlyBaseID:FBgn0030660 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_002878.2 Gene:RARS1 / 5917 HGNCID:9870 Length:660 Species:Homo sapiens


Alignment Length:142 Identity:43/142 - (30%)
Similarity:71/142 - (50%) Gaps:21/142 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   308 ASYILYNSARLEALLRKFNYE---VNNCAYEKLPLLDEIDLSVLEDDVDWELIYG-YLLTFPELM 368
            |:|:||...|:.::.|..|.:   :...|.|...|||.        :.:|:|  | .:|.|||::
Human   531 AAYLLYAFTRIRSIARLANIDEEMLQKAARETKILLDH--------EKEWKL--GRCILRFPEIL 585

  Fly   369 ESIMDQLDQGHCGLHLLVHYVENLAAAFSRFYYHKKVLLQKRD--ELMPILYARIYLIKAVRQVL 431
            :.|:|.|     .||.|..|:..||.||:.||.....:.:.|.  :::.:...|:.|.:||..|:
Human   586 QKILDDL-----FLHTLCDYIYELATAFTEFYDSCYCVEKDRQTGKILKVNMWRMLLCEAVAAVM 645

  Fly   432 NTALAVLGIEPV 443
            .....:|||:||
Human   646 AKGFDILGIKPV 657

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8097NP_573046.1 DALR_1 311..445 CDD:214846 41/139 (29%)
RARS1NP_002878.2 Could be involved in the assembly of the multisynthetase complex 1..72
PLN02286 80..660 CDD:215160 43/142 (30%)
'HIGH' region 201..212
Interaction with tRNA. /evidence=ECO:0000250|UniProtKB:Q05506 529..543 5/11 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.