DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8097 and dalrd3

DIOPT Version :9

Sequence 1:NP_001285279.1 Gene:CG8097 / 32495 FlyBaseID:FBgn0030660 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001116798.1 Gene:dalrd3 / 571036 ZFINID:ZDB-GENE-061103-415 Length:558 Species:Danio rerio


Alignment Length:230 Identity:57/230 - (24%)
Similarity:113/230 - (49%) Gaps:16/230 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 CGPVLEPINKGASSLTVDEYLKLRCQHMELMATQRSGMCPVPMSSLDTLTKRLAAAAVIVDLFVV 289
            ||||..|    ...:...:|.:||...|:..:..:.| ..|...:.|.:.:.:.:|.|..:|...
Zfish   331 CGPVKTP----GVQMNAAQYFQLRKAQMKEASEMKYG-DQVEGQTWDDIIRVMTSATVRFELLST 390

  Fly   290 RHSSAVSV-VRNGVGIC----KGASYILYNSARLEALLRKFNYEVNNCAYEKLPLLDEIDLSVLE 349
            .|:|.|:: |:...|:.    :|..:::||.|||..|...:...|....|.::|...|:|.|.|:
Zfish   391 VHTSPVTLDVQRDSGVSTKGPRGGVFVMYNCARLHTLFSSYEKGVEQGLYPEIPGGTELDFSALK 455

  Fly   350 DDVDWELIYGYLLTFPELMESIMDQLDQGHCGLHL------LVHYVENLAAAFSRFYYHKKVLLQ 408
            ::.:|.|::.||:.|.|:::.....|:....|..:      :..::.:|:..||.:|....||.:
Zfish   456 EEGEWLLLFNYLIPFSEILDQSAQTLEHEGGGARVQLRTEQVCRFLVSLSKDFSSYYNRVHVLGE 520

  Fly   409 KRDELMPILYARIYLIKAVRQVLNTALAVLGIEPV 443
            ....|...::.|:.|::|:|::.::||..|.:.|:
Zfish   521 PLPHLFNQMFCRLLLLRALRELYHSALDSLNLPPI 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8097NP_001285279.1 DALR_1 311..445 CDD:214846 36/139 (26%)
dalrd3NP_001116798.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..240
DALR_1 417..>528 CDD:214846 28/110 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579860
Domainoid 1 1.000 68 1.000 Domainoid score I9740
eggNOG 1 0.900 - - E1_COG0018
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1367114at2759
OrthoFinder 1 1.000 - - FOG0008240
OrthoInspector 1 1.000 - - oto40925
orthoMCL 1 0.900 - - OOG6_107731
Panther 1 1.100 - - LDO PTHR16043
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5723
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.740

Return to query results.
Submit another query.