DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8097 and rars1

DIOPT Version :9

Sequence 1:NP_001285279.1 Gene:CG8097 / 32495 FlyBaseID:FBgn0030660 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_956342.1 Gene:rars1 / 337070 ZFINID:ZDB-GENE-030131-9014 Length:661 Species:Danio rerio


Alignment Length:139 Identity:40/139 - (28%)
Similarity:68/139 - (48%) Gaps:15/139 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   308 ASYILYNSARLEALLRKFNYEVNNCAYEKLPLLDEIDLSVLEDDVDWELIYG-YLLTFPELMESI 371
            |:|:||...|:.::.|..|  :...|..|.....::   :|:.:.:|:|  | .:|.|||:::.|
Zfish   532 AAYLLYAFTRIRSIARLAN--IQEAALRKAAETTDV---ILDHEKEWKL--GKCILRFPEILQKI 589

  Fly   372 MDQLDQGHCGLHLLVHYVENLAAAFSRFYYHKKVLLQKRD--ELMPILYARIYLIKAVRQVLNTA 434
            .|.|     .||.|..|:..||..|:.||.....:.:.|.  |::.:...|:.|.:|...|:...
Zfish   590 TDDL-----LLHTLCDYLYELATTFTEFYDSCYCVEKDRQTGEVVKVNMWRMLLCEATAAVMAKG 649

  Fly   435 LAVLGIEPV 443
            ..:|||.||
Zfish   650 FDILGINPV 658

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8097NP_001285279.1 DALR_1 311..445 CDD:214846 38/136 (28%)
rars1NP_956342.1 MreC <5..>58 CDD:302802
PLN02286 79..661 CDD:215160 40/139 (29%)
Arg_tRNA_synt_N 79..167 CDD:214975
ArgRS_core 194..458 CDD:185675
Anticodon_Ia_like 497..661 CDD:299868 40/139 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0018
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.