DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8097 and Rars2

DIOPT Version :9

Sequence 1:NP_001285279.1 Gene:CG8097 / 32495 FlyBaseID:FBgn0030660 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001100113.1 Gene:Rars2 / 297969 RGDID:1305419 Length:578 Species:Rattus norvegicus


Alignment Length:230 Identity:58/230 - (25%)
Similarity:96/230 - (41%) Gaps:59/230 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 RCQHMEL-----MATQRSGMCPVP-------------MSSLDTLTK---------RLAAAAVIVD 285
            ||||:..     |.|:|..:..:.             |:|:.|..|         ::..||:|:.
  Rat   371 RCQHVPFGIVKGMKTRRGEVTFLEDVLNEVQSRMLQNMASIKTTKKMENPRETAEKVGLAALIIQ 435

  Fly   286 ----LFVVRHS---SAVSVVRNGVGICKGASYILYNSARLEALLRKFNYEVNNCAYEKLPLLDEI 343
                |.:..:.   ..|...|...|:     ::.|..|||.:|...|     .|.|     |::.
  Rat   436 DFRGLLLSDYQFSWDRVFQSRGDTGV-----FLQYTHARLCSLEETF-----GCGY-----LNDF 485

  Fly   344 DLSVLEDDVDWELIYGYLLTFPELMESIMDQLDQGHCGLHLLVHYVENLAAAFSRFYYHKKVLLQ 408
            :::.|::.....::. :||.|.|::.:....|...|...:||.  :.:|||.     .||  .||
  Rat   486 NVACLQEPQSVSILQ-HLLRFDEVLYTASQDLQPKHIVSYLLT--LSHLAAV-----AHK--TLQ 540

  Fly   409 KRDELMPILYARIYLIKAVRQVLNTALAVLGIEPV 443
            .:|....:..||::|.||||.||...:.:|||.||
  Rat   541 VKDSPPEVAGARLHLFKAVRSVLANGMKLLGITPV 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8097NP_001285279.1 DALR_1 311..445 CDD:214846 40/133 (30%)
Rars2NP_001100113.1 ArgS 30..578 CDD:223097 58/230 (25%)
ArgRS_core 126..388 CDD:185675 6/16 (38%)
Anticodon_Ia_like 425..578 CDD:299868 47/176 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0018
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.