DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8097 and Rars1

DIOPT Version :9

Sequence 1:NP_001285279.1 Gene:CG8097 / 32495 FlyBaseID:FBgn0030660 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001099247.2 Gene:Rars1 / 287191 RGDID:1309215 Length:660 Species:Rattus norvegicus


Alignment Length:142 Identity:41/142 - (28%)
Similarity:70/142 - (49%) Gaps:21/142 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   308 ASYILYNSARLEALLRKFNYE---VNNCAYEKLPLLDEIDLSVLEDDVDWELIYG-YLLTFPELM 368
            |:|:||...|:.::.|..|.:   :...|.|...:||.        :.:|:|  | .:|.|||::
  Rat   531 AAYLLYAFTRIRSIARLANIDEEMLQRAARETKIILDH--------EKEWKL--GRCILRFPEIL 585

  Fly   369 ESIMDQLDQGHCGLHLLVHYVENLAAAFSRFYYHKKVLLQKRD--ELMPILYARIYLIKAVRQVL 431
            :.|:|.|     .||.|..|:..||..|:.||.....:.:.|.  :::.:...|:.|.:||..|:
  Rat   586 QKILDDL-----FLHTLCDYIYELATTFTEFYDSCYCVEKDRQTGKVLKVNMWRMLLCEAVAAVM 645

  Fly   432 NTALAVLGIEPV 443
            .....:|||:||
  Rat   646 AKGFDILGIKPV 657

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8097NP_001285279.1 DALR_1 311..445 CDD:214846 39/139 (28%)
Rars1NP_001099247.2 Could be involved in the assembly of the multisynthetase complex. /evidence=ECO:0000250 1..72
Arg_tRNA_synt_N 79..166 CDD:214975
PLN02286 80..660 CDD:215160 41/142 (29%)
ArgRS_core 193..457 CDD:185675
L-arginine binding. /evidence=ECO:0000250|UniProtKB:P54136 200..202
'HIGH' region. /evidence=ECO:0000250 201..212
Anticodon_Ia_like 498..660 CDD:299868 41/142 (29%)
Interaction with tRNA. /evidence=ECO:0000250|UniProtKB:Q05506 529..543 5/11 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0018
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.