DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9215 and ZNF382

DIOPT Version :9

Sequence 1:NP_573045.1 Gene:CG9215 / 32494 FlyBaseID:FBgn0030659 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_116214.2 Gene:ZNF382 / 84911 HGNCID:17409 Length:550 Species:Homo sapiens


Alignment Length:230 Identity:76/230 - (33%)
Similarity:108/230 - (46%) Gaps:22/230 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 ENTPEHL------YEIETPLIEESVVASPPLPLPPTHPANQQKKRTYRRVSPNVKHEK------- 280
            |..|.|.      :..::.|||...:.:...|    :..||..| .:|:.:....|||       
Human   292 EEKPFHCPYCGNNFRRKSYLIEHQRIHTGEKP----YVCNQCGK-AFRQKTALTLHEKTHIEGKP 351

  Fly   281 -LTANVDDDFKAGST-TKRRNCERSPKI--CDVCGNTYKYQHALNAHMRRHNNERPYSCEVCQKA 341
             :..:....|:..:| |:........|.  |..||:.::.:..|..|.|.|..|:||.|..|.||
Human   352 FICIDCGKSFRQKATLTRHHKTHTGEKAYECPQCGSAFRKKSYLIDHQRTHTGEKPYQCNECGKA 416

  Fly   342 FISNVELRRHMRVHTGQKPYSCRHCERRFSDFGSSKKHERIHTGERPYVCEVCNKGFAYAHVLSA 406
            ||....|..|.|.|||:|||.|..|.:.|....:...|:||||||:||:|..|.|.|....:|:.
Human   417 FIQKTTLTVHQRTHTGEKPYICNECGKSFCQKTTLTLHQRIHTGEKPYICNECGKSFRQKAILTV 481

  Fly   407 HRRTHTGKKQFQCTQCDKGFTKKTYLSAHMEQHRG 441
            |.|.|||:|...|.||.|.|::|:.|..|.:.|.|
Human   482 HHRIHTGEKSNGCPQCGKAFSRKSNLIRHQKTHTG 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9215NP_573045.1 zf-AD 16..92 CDD:285071
DUF2117 165..>273 CDD:303038 11/49 (22%)
COG5048 <303..439 CDD:227381 57/137 (42%)
C2H2 Zn finger 307..327 CDD:275368 6/19 (32%)
zf-H2C2_2 319..344 CDD:290200 12/24 (50%)
zf-C2H2 333..355 CDD:278523 10/21 (48%)
C2H2 Zn finger 335..355 CDD:275368 9/19 (47%)
zf-H2C2_2 347..371 CDD:290200 11/23 (48%)
C2H2 Zn finger 363..383 CDD:275368 5/19 (26%)
zf-H2C2_2 375..400 CDD:290200 13/24 (54%)
C2H2 Zn finger 391..411 CDD:275368 7/19 (37%)
zf-H2C2_2 404..427 CDD:290200 11/22 (50%)
C2H2 Zn finger 419..439 CDD:275368 8/19 (42%)
ZNF382NP_116214.2 Mediates interaction with TRIM28. /evidence=ECO:0000250 1..105
Represses transcription. /evidence=ECO:0000250 5..46
KRAB 7..67 CDD:214630
KRAB 7..46 CDD:279668
Represses transcription. /evidence=ECO:0000250 70..211
C2H2 Zn finger 214..234 CDD:275368
Required for transcriptional repression activity, probably mediates sequence-specific DNA-binding. /evidence=ECO:0000250 296..550 74/226 (33%)
C2H2 Zn finger 298..318 CDD:275368 3/19 (16%)
zf-H2C2_2 310..335 CDD:290200 7/29 (24%)
C2H2 Zn finger 326..346 CDD:275368 7/20 (35%)
COG5048 <354..533 CDD:227381 62/163 (38%)
C2H2 Zn finger 354..374 CDD:275368 3/19 (16%)
zf-H2C2_2 367..389 CDD:290200 5/21 (24%)
C2H2 Zn finger 382..402 CDD:275368 6/19 (32%)
zf-H2C2_2 394..419 CDD:290200 12/24 (50%)
C2H2 Zn finger 410..430 CDD:275368 9/19 (47%)
zf-H2C2_2 423..445 CDD:290200 11/21 (52%)
C2H2 Zn finger 438..458 CDD:275368 5/19 (26%)
zf-H2C2_2 451..475 CDD:290200 13/23 (57%)
C2H2 Zn finger 466..486 CDD:275368 7/19 (37%)
C2H2 Zn finger 494..514 CDD:275368 8/19 (42%)
zf-C2H2 494..514 CDD:278523 8/19 (42%)
zf-H2C2_2 506..531 CDD:290200 4/11 (36%)
C2H2 Zn finger 522..542 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24404
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.