DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9215 and ZNF148

DIOPT Version :9

Sequence 1:NP_573045.1 Gene:CG9215 / 32494 FlyBaseID:FBgn0030659 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_001335353.1 Gene:ZNF148 / 7707 HGNCID:12933 Length:794 Species:Homo sapiens


Alignment Length:457 Identity:107/457 - (23%)
Similarity:184/457 - (40%) Gaps:111/457 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 VSGTITTSTEPSEDVKEEKTDSLSLIPDGAMVLSLNDFQAQDSITQ---QAEEKDPKKQQDEDEG 216
            |||..|.|.|..:.|.::::.....|.....||..::.:.||.|:.   ...|:..|..:::.| 
Human    32 VSGQSTVSGELQDSVLQDRSMPHQEILAADEVLQESEMRQQDMISHDELMVHEETVKNDEEQME- 95

  Fly   217 QAKMLELDPWDDENTPEHL-YEIETPLIEESVVASPPLPLPPTHPANQQKKRTYRRVSPNVKHEK 280
                      ..|..|:.| |.:..|:                   :.:::.|:..||..:..:|
Human    96 ----------THERLPQGLQYALNVPI-------------------SVKQEITFTDVSEQLMRDK 131

  Fly   281 LTANVDDDFKAGSTTKRRNCERSP-KICDVCGNTYKYQHALNAHMRRHNNE---------RPYSC 335
            .......|.:    .|::..:||| ||..:                   ||         :.:.|
Human   132 KQIREPVDLQ----KKKKRKQRSPAKILTI-------------------NEDGSLGLKTPKSHVC 173

  Fly   336 EVCQKAFISNVELRRHMRVHTGQKPYSCRHCERRFSDFGSSKKHERIHTGERPYVCEVCNKGFAY 400
            |.|..||.:|..|:||:.:|||:||:.|..|:.||......::||:|||||:|:.|:.|...|..
Human   174 EHCNAAFRTNYHLQRHVFIHTGEKPFQCSQCDMRFIQKYLLQRHEKIHTGEKPFRCDECGMRFIQ 238

  Fly   401 AHVLSAHRRTHTGKKQFQCTQCDKGFTKKTYLSAHM----EQHRGSGN------GEASVASSSAD 455
            .:.:..|:|||:|:|.:||..|.:.|::...:..|.    |.|....|      |..:....|..
Human   239 KYHMERHKRTHSGEKPYQCEYCLQYFSRTDRVLKHKRMCHENHDKKLNRCAIKGGLLTSEEDSGF 303

  Fly   456 ASSRNQNA---SARKESARKQQQIPESFSLDSVELEQ------------TKVLEECIVANDFMFN 505
            ::|...|:   ..|:::.:|...:.:..:||..:|::            |||.:|.:||      
Human   304 STSPKDNSLPKKKRQKTEKKSSGMDKESALDKSDLKKDKNDYLPLYSSSTKVKDEYMVA------ 362

  Fly   506 EEDNAEQEANDREGLQHDDS----YPYVGGYQSVDSVKELVGDL--------LDTEEFCDESKYM 558
             |...|...:...|...:|:    :|.....:.::|.:.|...|        |.|.|....|||.
Human   363 -EYAVEMPHSSVGGSHLEDASGEIHPPKLVLKKINSKRSLKQPLEQNQTISPLSTYEESKVSKYA 426

  Fly   559 IE 560
            .|
Human   427 FE 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9215NP_573045.1 zf-AD 16..92 CDD:285071
DUF2117 165..>273 CDD:303038 16/111 (14%)
COG5048 <303..439 CDD:227381 47/149 (32%)
C2H2 Zn finger 307..327 CDD:275368 0/19 (0%)
zf-H2C2_2 319..344 CDD:290200 7/33 (21%)
zf-C2H2 333..355 CDD:278523 9/21 (43%)
C2H2 Zn finger 335..355 CDD:275368 9/19 (47%)
zf-H2C2_2 347..371 CDD:290200 11/23 (48%)
C2H2 Zn finger 363..383 CDD:275368 6/19 (32%)
zf-H2C2_2 375..400 CDD:290200 11/24 (46%)
C2H2 Zn finger 391..411 CDD:275368 5/19 (26%)
zf-H2C2_2 404..427 CDD:290200 9/22 (41%)
C2H2 Zn finger 419..439 CDD:275368 5/23 (22%)
ZNF148NP_001335353.1 zf-C2H2 171..193 CDD:395048 9/21 (43%)
C2H2 Zn finger 173..193 CDD:275368 9/19 (47%)
zf-H2C2_2 185..210 CDD:404364 12/24 (50%)
C2H2 Zn finger 201..221 CDD:275368 6/19 (32%)
zf-H2C2_2 214..238 CDD:404364 11/23 (48%)
C2H2 Zn finger 229..249 CDD:275368 5/19 (26%)
zf-H2C2_2 241..266 CDD:404364 10/24 (42%)
C2H2 Zn finger 257..275 CDD:275368 4/17 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 298..336 7/37 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 574..596
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24404
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.