DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9215 and Zfp821

DIOPT Version :9

Sequence 1:NP_573045.1 Gene:CG9215 / 32494 FlyBaseID:FBgn0030659 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_001161418.1 Gene:Zfp821 / 75871 MGIID:1923121 Length:413 Species:Mus musculus


Alignment Length:379 Identity:71/379 - (18%)
Similarity:113/379 - (29%) Gaps:157/379 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 GAMVLSLNDFQAQDSITQQAEEKDPKKQQD--------EDEGQAKMLELDPWDDENTPEHLYEIE 239
            |:...::...:.|||.:..:|..:.:..||        ||.|..|:           .:.|...|
Mouse    39 GSQRQAIQQLRDQDSSSSDSEGDEEETTQDEVSSHTSEEDGGVVKV-----------EKELETAE 92

  Fly   240 TPLIEESVVASPPLPLPPTHPANQQKKRTYRRVSPNVKHEKLTANVDDDFKAGSTTKRRNCERSP 304
            .|:.....:|.                   |.|:.|:..:.|.               :.|:   
Mouse    93 APVSSGDALAE-------------------REVTENLNSDPLL---------------QLCQ--- 120

  Fly   305 KICDVCGNTYKYQHALNAHMRRHN----NERPYSCEVCQKAFISNVELRRHMRVHTGQKPYSCRH 365
              |.:|......:..|.||:.:|.    :.:.|.|.||.:|..|...|.||:.:|:..:..:|..
Mouse   121 --CPLCQLDCGSREQLIAHVYQHTAAVVSAKSYMCPVCGRALSSPGSLGRHLLIHSEDQRSNCAV 183

  Fly   366 CERRFSD---FGSSKKHE--------RIHTGERPYVCE-----------------VCNKGFAYAH 402
            |..||:.   |.|.|..:        ::|: |.|...|                 |||...||..
Mouse   184 CGARFTSHATFNSEKLPQVLNMESVPQVHS-EGPSSAEGKDIACSPPVYPAGILLVCNNCAAYRK 247

  Fly   403 VLSAHRRTHTGKKQFQCTQCDKGFTKKTYLSAHMEQHRGSGNGEASVASSSADASSRNQNASARK 467
            :|                                                      ..|..|.||
Mouse   248 LL------------------------------------------------------ETQTPSVRK 258

  Fly   468 ESARKQQQIPESFSLDSVELEQTKVLEECIVANDFMFNEEDNAEQEA---NDRE 518
            .:.|:|.: |....|..:|.|:|        |.....:.|...|:|.   .|||
Mouse   259 WALRRQNE-PLEVRLQRLERERT--------AKKSRRDNETPEEREVRRMRDRE 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9215NP_573045.1 zf-AD 16..92 CDD:285071
DUF2117 165..>273 CDD:303038 16/97 (16%)
COG5048 <303..439 CDD:227381 33/167 (20%)
C2H2 Zn finger 307..327 CDD:275368 5/19 (26%)
zf-H2C2_2 319..344 CDD:290200 9/28 (32%)
zf-C2H2 333..355 CDD:278523 9/21 (43%)
C2H2 Zn finger 335..355 CDD:275368 8/19 (42%)
zf-H2C2_2 347..371 CDD:290200 7/23 (30%)
C2H2 Zn finger 363..383 CDD:275368 7/30 (23%)
zf-H2C2_2 375..400 CDD:290200 9/49 (18%)
C2H2 Zn finger 391..411 CDD:275368 7/36 (19%)
zf-H2C2_2 404..427 CDD:290200 1/22 (5%)
C2H2 Zn finger 419..439 CDD:275368 0/19 (0%)
Zfp821NP_001161418.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..83 10/43 (23%)
C2H2 Zn finger 121..141 CDD:275368 5/19 (26%)
zf-C2H2 151..173 CDD:333835 9/21 (43%)
C2H2 Zn finger 153..173 CDD:275368 8/19 (42%)
DUF460 <243..383 CDD:391696 21/124 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 279..320 8/33 (24%)
DUF1682 <290..355 CDD:369610 5/14 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24404
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.