DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9215 and Znf740

DIOPT Version :9

Sequence 1:NP_573045.1 Gene:CG9215 / 32494 FlyBaseID:FBgn0030659 Length:560 Species:Drosophila melanogaster
Sequence 2:XP_006242517.1 Gene:Znf740 / 685834 RGDID:1589052 Length:205 Species:Rattus norvegicus


Alignment Length:150 Identity:41/150 - (27%)
Similarity:67/150 - (44%) Gaps:28/150 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 PANQQKKRTYRRVSPNVKHEKLTANVDDDFKAGSTTKRRNCE-------------RSPK--ICDV 309
            |......:.:|:.|...::.|     |||..|.::..::..:             :.||  ||:.
  Rat    58 PRFDLSSKGHRKDSDKSRNRK-----DDDTLAEASHSKKTVKKVVVVEQNGSFQVKIPKNFICEH 117

  Fly   310 CGNTYKYQHALNAHMRRHNNERPYSCEVCQKAFISNVELRRHMRVHTGQKPYSCRHCERRFSDFG 374
            |...::..:.|..|:..|..|:|:.|:||...||....|.||.|||:|:|||.|..|.:.||...
  Rat   118 CFGAFRSSYHLKRHVLIHTGEKPFECDVCDMRFIQKYHLERHKRVHSGEKPYQCERCHQCFSRTD 182

  Fly   375 SSKKHERIHTGERPYVCEVC 394
            ...:|:|        :|:.|
  Rat   183 RLLRHKR--------MCQGC 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9215NP_573045.1 zf-AD 16..92 CDD:285071
DUF2117 165..>273 CDD:303038 2/12 (17%)
COG5048 <303..439 CDD:227381 32/93 (34%)
C2H2 Zn finger 307..327 CDD:275368 4/19 (21%)
zf-H2C2_2 319..344 CDD:290200 9/24 (38%)
zf-C2H2 333..355 CDD:278523 9/21 (43%)
C2H2 Zn finger 335..355 CDD:275368 9/19 (47%)
zf-H2C2_2 347..371 CDD:290200 12/23 (52%)
C2H2 Zn finger 363..383 CDD:275368 6/19 (32%)
zf-H2C2_2 375..400 CDD:290200 3/19 (16%)
C2H2 Zn finger 391..411 CDD:275368 1/3 (33%)
zf-H2C2_2 404..427 CDD:290200
C2H2 Zn finger 419..439 CDD:275368
Znf740XP_006242517.1 C2H2 Zn finger 115..135 CDD:275368 4/19 (21%)
zf-H2C2_2 127..152 CDD:290200 9/24 (38%)
C2H2 Zn finger 143..163 CDD:275368 9/19 (47%)
zf-H2C2_2 155..180 CDD:290200 13/24 (54%)
C2H2 Zn finger 171..189 CDD:275368 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24404
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.