| Sequence 1: | NP_573045.1 | Gene: | CG9215 / 32494 | FlyBaseID: | FBgn0030659 | Length: | 560 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001347505.1 | Gene: | Zfp110 / 65020 | MGIID: | 1890378 | Length: | 832 | Species: | Mus musculus |
| Alignment Length: | 215 | Identity: | 61/215 - (28%) |
|---|---|---|---|
| Similarity: | 103/215 - (47%) | Gaps: | 19/215 - (8%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 243 IEESVVASPPLPLPPTHPANQQKKRTYRRVSPNVKHEKLTANVDDDFKAGSTTKRRNCERSPKI- 306
Fly 307 -----------------CDVCGNTYKYQHALNAHMRRHNNERPYSCEVCQKAFISNVELRRHMRV 354
Fly 355 HTGQKPYSCRHCERRFSDFGSSKKHERIHTGERPYVCEVCNKGFAYAHVLSAHRRTHTGKKQFQC 419
Fly 420 TQCDKGFTKKTYLSAHMEQH 439 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG9215 | NP_573045.1 | zf-AD | 16..92 | CDD:285071 | |
| DUF2117 | 165..>273 | CDD:303038 | 5/29 (17%) | ||
| COG5048 | <303..439 | CDD:227381 | 51/153 (33%) | ||
| C2H2 Zn finger | 307..327 | CDD:275368 | 4/19 (21%) | ||
| zf-H2C2_2 | 319..344 | CDD:290200 | 11/24 (46%) | ||
| zf-C2H2 | 333..355 | CDD:278523 | 9/21 (43%) | ||
| C2H2 Zn finger | 335..355 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 347..371 | CDD:290200 | 9/23 (39%) | ||
| C2H2 Zn finger | 363..383 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 375..400 | CDD:290200 | 12/24 (50%) | ||
| C2H2 Zn finger | 391..411 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 404..427 | CDD:290200 | 10/22 (45%) | ||
| C2H2 Zn finger | 419..439 | CDD:275368 | 7/19 (37%) | ||
| Zfp110 | NP_001347505.1 | KRAB | 18..77 | CDD:214630 | |
| SCAN | 159..246 | CDD:307924 | |||
| KRAB | 283..324 | CDD:307490 | |||
| C2H2 Zn finger | 663..682 | CDD:275370 | 2/18 (11%) | ||
| C2H2 Zn finger | 690..710 | CDD:275368 | 4/19 (21%) | ||
| zf-H2C2_2 | 702..727 | CDD:316026 | 11/24 (46%) | ||
| C2H2 Zn finger | 718..738 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 730..754 | CDD:316026 | 9/23 (39%) | ||
| C2H2 Zn finger | 746..766 | CDD:275368 | 7/19 (37%) | ||
| zf-C2H2 | 772..794 | CDD:306579 | 9/21 (43%) | ||
| C2H2 Zn finger | 774..794 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 786..811 | CDD:316026 | 11/24 (46%) | ||
| C2H2 Zn finger | 802..822 | CDD:275368 | 7/19 (37%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||