| Sequence 1: | NP_573045.1 | Gene: | CG9215 / 32494 | FlyBaseID: | FBgn0030659 | Length: | 560 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001344376.1 | Gene: | Zfp24 / 59057 | MGIID: | 1929704 | Length: | 368 | Species: | Mus musculus |
| Alignment Length: | 269 | Identity: | 81/269 - (30%) |
|---|---|---|---|
| Similarity: | 110/269 - (40%) | Gaps: | 55/269 - (20%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 167 EDVKEEKTDSLSLIPDGAMVLSLNDFQAQ---DSITQQAEEKD-PKKQQDEDEGQAK-----MLE 222
Fly 223 LDPWDDENTPEHLYEIETPLIEESVVASPPLPLPPTHPANQQKKRTYRRVSPNVKHE---KLTAN 284
Fly 285 VDDDFKAGST-------TKRRNCERSPK-ICDVCGNTYKYQHALNAHMRRHNNERPYSCEVCQKA 341
Fly 342 FISNVELRRHMRVHTGQKPYSCRHCERRFSDFGSSKKHERIHTGERPYVCEVCNKGFAYAHVLSA 406
Fly 407 HRRTHTGKK 415 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG9215 | NP_573045.1 | zf-AD | 16..92 | CDD:285071 | |
| DUF2117 | 165..>273 | CDD:303038 | 20/114 (18%) | ||
| COG5048 | <303..439 | CDD:227381 | 49/114 (43%) | ||
| C2H2 Zn finger | 307..327 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 319..344 | CDD:290200 | 13/24 (54%) | ||
| zf-C2H2 | 333..355 | CDD:278523 | 9/21 (43%) | ||
| C2H2 Zn finger | 335..355 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 347..371 | CDD:290200 | 12/23 (52%) | ||
| C2H2 Zn finger | 363..383 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 375..400 | CDD:290200 | 12/24 (50%) | ||
| C2H2 Zn finger | 391..411 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 404..427 | CDD:290200 | 5/12 (42%) | ||
| C2H2 Zn finger | 419..439 | CDD:275368 | |||
| Zfp24 | NP_001344376.1 | SCAN | 48..159 | CDD:128708 | 8/37 (22%) |
| COG5048 | <249..329 | CDD:227381 | 34/79 (43%) | ||
| Necessary and sufficient for nuclear localization. /evidence=ECO:0000250 | 251..301 | 21/49 (43%) | |||
| C2H2 Zn finger | 253..273 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 281..301 | CDD:275368 | 8/19 (42%) | ||
| COG5048 | 305..>358 | CDD:227381 | 22/52 (42%) | ||
| C2H2 Zn finger | 309..329 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 337..357 | CDD:275368 | 6/19 (32%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 1 | 1.000 | - | - | ||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.000 | |||||