DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9215 and Zscan4d

DIOPT Version :9

Sequence 1:NP_573045.1 Gene:CG9215 / 32494 FlyBaseID:FBgn0030659 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_001093656.1 Gene:Zscan4d / 545913 MGIID:3645954 Length:506 Species:Mus musculus


Alignment Length:387 Identity:95/387 - (24%)
Similarity:147/387 - (37%) Gaps:109/387 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 CTSLQLDS-SPSQLQRWPDKICKQCHLELSVSYRFHEKCTAVQKLFRSASRSTSTSAV-FAAAAA 110
            |:..::|| ...|.:::|:      |.|.:|.::|....       |.||:..|:..| |.:|..
Mouse   202 CSGNEMDSLLIIQKEQYPE------HEEGNVVFQFPLDA-------RRASQGNSSHHVDFRSAPT 253

  Fly   111 APPAPMLVDKQQEQLKLDLEQAHVRLPATLKIRRLNVEPCSSSSVSGTITTSTEPSEDVKEEKTD 175
            ....||     :||            |..|....::.:..:..:.|....|....|:::..:|||
Mouse   254 PADVPM-----EEQ------------PKDLSRENISEDKNNCYNTSRNAATQVYRSDNIPRKKTD 301

  Fly   176 SLSL-------------IPDGAMVLSLNDFQA-----QDSITQQAEEKDPKKQQDEDEGQAKMLE 222
            |||:             ||.|....|....|.     |:|:.:...||||::....:..|     
Mouse   302 SLSINKRIYHSEPEEGDIPYGVPQDSTRASQGTSTCLQESLGECFSEKDPRELPGLESRQ----- 361

  Fly   223 LDPWDDENTPEHLYEIETPLIEESVVASPPLPLPPTHPANQQKKRTYRRVSPNVKHEKLTANVDD 287
                            |.|:       |.|:.|...|.||          .|...|:|       
Mouse   362 ----------------EEPI-------SDPVFLGKDHEAN----------LPCESHQK------- 386

  Fly   288 DFKAGSTTKRRNCERSPKI--CDVCGNTYKYQHALNAHMRRH-NNERPYSCEVCQKAFISNVELR 349
                       ...|..|:  |:.|...:|:..:|::|.|.| |.:....|..|||.|....:.|
Mouse   387 -----------RFRRDAKLFKCEECSRMFKHARSLSSHQRTHLNKKSELLCVTCQKMFKRVSDRR 440

  Fly   350 RHMRVHTGQKPYSCRHCERRFSDFGSSKKHERIHTGERPYVCEVCNKGFAYAHVLSAHRRTH 411
            .|..:|..:||:.|..||:.||...:.|.||.|||||.||||.:|::.|..:.....|.|.:
Mouse   441 THEIIHMPEKPFKCSTCEKSFSHKTNLKSHEMIHTGEMPYVCSLCSRRFRQSSTYHRHLRNY 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9215NP_573045.1 zf-AD 16..92 CDD:285071 9/44 (20%)
DUF2117 165..>273 CDD:303038 27/125 (22%)
COG5048 <303..439 CDD:227381 40/112 (36%)
C2H2 Zn finger 307..327 CDD:275368 6/19 (32%)
zf-H2C2_2 319..344 CDD:290200 10/25 (40%)
zf-C2H2 333..355 CDD:278523 7/21 (33%)
C2H2 Zn finger 335..355 CDD:275368 7/19 (37%)
zf-H2C2_2 347..371 CDD:290200 8/23 (35%)
C2H2 Zn finger 363..383 CDD:275368 8/19 (42%)
zf-H2C2_2 375..400 CDD:290200 14/24 (58%)
C2H2 Zn finger 391..411 CDD:275368 5/19 (26%)
zf-H2C2_2 404..427 CDD:290200 2/8 (25%)
C2H2 Zn finger 419..439 CDD:275368
Zscan4dNP_001093656.1 SCAN <51..117 CDD:295388
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 238..264 9/42 (21%)
zf-C2H2 395..417 CDD:278523 6/21 (29%)
C2H2 Zn finger 397..417 CDD:275368 6/19 (32%)
C2H2 Zn finger 426..446 CDD:275368 7/19 (37%)
zf-H2C2_2 438..463 CDD:290200 9/24 (38%)
C2H2 Zn finger 454..474 CDD:275368 8/19 (42%)
zf-H2C2_2 466..491 CDD:290200 14/24 (58%)
C2H2 Zn finger 482..500 CDD:275368 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.