DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9215 and zgc:113102

DIOPT Version :9

Sequence 1:NP_573045.1 Gene:CG9215 / 32494 FlyBaseID:FBgn0030659 Length:560 Species:Drosophila melanogaster
Sequence 2:XP_009297414.1 Gene:zgc:113102 / 503754 ZFINID:ZDB-GENE-050306-35 Length:281 Species:Danio rerio


Alignment Length:184 Identity:71/184 - (38%)
Similarity:99/184 - (53%) Gaps:18/184 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 THPANQQKKRTYRRVSPNVKHEKLTANVDDDFKAGSTTKRRNCERSPKICDVCGNTYKYQHALNA 322
            ||..:|..| |:.|.|...:|                 .|.:.|..|..|.|||.|::::.....
Zfish    76 THQCDQCGK-TFLRASALKRH-----------------LRVHTEGKPYSCTVCGKTFRHEDGFKN 122

  Fly   323 HMRRHNNERPYSCEVCQKAFISNVELRRHMRVHTGQKPYSCRHCERRFSDFGSSKKHERIHTGER 387
            |.:.|...|.:.|..|:|.||:.|:|:.|.|.|||::||.|.||::|||..||..||:||||||:
Zfish   123 HQKIHTGMREHICLECEKTFITAVKLKIHERTHTGERPYKCSHCDKRFSQLGSLIKHKRIHTGEK 187

  Fly   388 PYVCEVCNKGFAYAHVLSAHRRTHTGKKQFQCTQCDKGFTKKTYLSAHMEQHRG 441
            ||.|..|:|.|..:.:|..|.|.|||:|.::|:.|||.|.:...|..|...|.|
Zfish   188 PYKCSYCDKRFNQSGILKKHERIHTGEKPYKCSHCDKRFNQSGILKTHERIHTG 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9215NP_573045.1 zf-AD 16..92 CDD:285071
DUF2117 165..>273 CDD:303038 6/14 (43%)
COG5048 <303..439 CDD:227381 59/135 (44%)
C2H2 Zn finger 307..327 CDD:275368 6/19 (32%)
zf-H2C2_2 319..344 CDD:290200 7/24 (29%)
zf-C2H2 333..355 CDD:278523 9/21 (43%)
C2H2 Zn finger 335..355 CDD:275368 9/19 (47%)
zf-H2C2_2 347..371 CDD:290200 12/23 (52%)
C2H2 Zn finger 363..383 CDD:275368 11/19 (58%)
zf-H2C2_2 375..400 CDD:290200 15/24 (63%)
C2H2 Zn finger 391..411 CDD:275368 7/19 (37%)
zf-H2C2_2 404..427 CDD:290200 11/22 (50%)
C2H2 Zn finger 419..439 CDD:275368 7/19 (37%)
zgc:113102XP_009297414.1 C2H2 Zn finger 23..43 CDD:275368
zf-H2C2_2 35..60 CDD:290200
C2H2 Zn finger 51..71 CDD:275368
C2H2 Zn finger 79..99 CDD:275368 7/37 (19%)
C2H2 Zn finger 107..127 CDD:275368 6/19 (32%)
C2H2 Zn finger 135..155 CDD:275368 9/19 (47%)
zf-H2C2_2 148..172 CDD:290200 13/23 (57%)
C2H2 Zn finger 163..183 CDD:275368 11/19 (58%)
zf-H2C2_2 175..200 CDD:290200 15/24 (63%)
C2H2 Zn finger 191..211 CDD:275368 7/19 (37%)
zf-H2C2_2 204..228 CDD:290200 12/23 (52%)
C2H2 Zn finger 219..239 CDD:275368 7/19 (37%)
C2H2 Zn finger 247..267 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24404
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.