DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9215 and CG17806

DIOPT Version :9

Sequence 1:NP_573045.1 Gene:CG9215 / 32494 FlyBaseID:FBgn0030659 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster


Alignment Length:456 Identity:104/456 - (22%)
Similarity:178/456 - (39%) Gaps:90/456 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 CLVCLAEEPEASSIYGHDPESPHMLILDKIRCCTSLQLDSSPSQLQRWPDKICKQCHLELSVSYR 80
            |..|..|...|.|::..:...    :|..|...|...|.:.|..    |.:||..|.|:|:.:..
  Fly     5 CRTCGQEAEHAKSLFDKEARD----VLSNILKLTGFWLRNQPGV----PTRICLSCLLDLNDAIA 61

  Fly    81 FHEKCTAVQKLFRSASRSTSTSAVFAAAAAAPPAPMLVDKQQEQLKLDLEQA----HVRLPATLK 141
            |.|:|.          |:.|:               ..:||.:|...|.|.|    :.||.:.:.
  Fly    62 FRERCI----------RTNSS---------------WFEKQGKQEDSDTETAREGGNNRLESRVD 101

  Fly   142 I--------RRLNVEPCSSSSVSG----TITTSTEPSEDVKEEKTDSLSLIPDGAMVLSLNDFQA 194
            :        :|..:.|..|..|.|    |:.|...|            .::|:......::..:.
  Fly   102 VMPISIAQPQRRRILPQRSKKVDGVPLKTVETPIYP------------LVVPEIPPADLVDPLRC 154

  Fly   195 QDSITQQAEEK----DPKKQQDEDEGQAKMLELDPWDDENTPEHLYEIE----TPLIEESVVASP 251
            :|.|..::|.:    .|.:..:.:|..::|.::.. ::..|.:.:.|::    .|..:..:...|
  Fly   155 EDPIQVKSEPQLSSDYPVESMNHEEPASEMPQVMK-EEPRTLQVIGEVQKNRRKPRSKGCLEECP 218

  Fly   252 PLPLPPTHPANQQKKRTYRRVSPNVKHEK-LTANVDDDFKAGSTTKRRNCERSPKICDVCGNTYK 315
            ...:......:....:|        |.|| .|.|     |.|:..:....|.....||.||.|:.
  Fly   219 GKDMAKIENIDSTTNKT--------KEEKYATRN-----KWGAAKRAYALEHRLYFCDQCGKTFS 270

  Fly   316 YQHALNAHMRRHNNERPYSCEVCQKAFISNVELRRHMRV-HTGQKPYSCRHCERRFSDFGSSKKH 379
            .:...|.|:|||...:.:.|:.|.:...:...|..|:|: |.|:.||.|::|.:||.:......|
  Fly   271 EKGNFNVHLRRHKGTKEFQCQECDRMEFTQHLLNLHVRIKHRGELPYVCKYCGKRFDNCLKRLNH 335

  Fly   380 ERIHTG---ERPYVCEVCNKGFAYAHVLSAHRRTHTGKKQFQCTQCDKGFTKKTYLSAH--MEQH 439
            ||.|..   .||:||..|.|.|..:..|..|...|||::.|.|..|...|.::..|:.|  .:.|
  Fly   336 ERNHKESPVHRPHVCSTCQKAFKTSTALKDHIVVHTGEQPFHCELCQTFFNRRNALATHYKSKHH 400

  Fly   440 R 440
            |
  Fly   401 R 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9215NP_573045.1 zf-AD 16..92 CDD:285071 19/75 (25%)
DUF2117 165..>273 CDD:303038 13/115 (11%)
COG5048 <303..439 CDD:227381 45/141 (32%)
C2H2 Zn finger 307..327 CDD:275368 8/19 (42%)
zf-H2C2_2 319..344 CDD:290200 7/24 (29%)
zf-C2H2 333..355 CDD:278523 5/22 (23%)
C2H2 Zn finger 335..355 CDD:275368 5/20 (25%)
zf-H2C2_2 347..371 CDD:290200 10/24 (42%)
C2H2 Zn finger 363..383 CDD:275368 7/19 (37%)
zf-H2C2_2 375..400 CDD:290200 11/27 (41%)
C2H2 Zn finger 391..411 CDD:275368 6/19 (32%)
zf-H2C2_2 404..427 CDD:290200 8/22 (36%)
C2H2 Zn finger 419..439 CDD:275368 5/21 (24%)
CG17806NP_650658.1 zf-AD 4..76 CDD:285071 21/103 (20%)
zf-C2H2 260..282 CDD:278523 8/21 (38%)
C2H2 Zn finger 262..282 CDD:275368 8/19 (42%)
C2H2 Zn finger 290..311 CDD:275368 5/20 (25%)
COG5048 <298..>383 CDD:227381 30/84 (36%)
C2H2 Zn finger 319..339 CDD:275368 7/19 (37%)
C2H2 Zn finger 350..370 CDD:275368 6/19 (32%)
ZnF_U1 375..407 CDD:197732 8/27 (30%)
C2H2 Zn finger 378..396 CDD:275368 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.