DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9215 and CG6654

DIOPT Version :9

Sequence 1:NP_573045.1 Gene:CG9215 / 32494 FlyBaseID:FBgn0030659 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_650429.1 Gene:CG6654 / 41831 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster


Alignment Length:596 Identity:138/596 - (23%)
Similarity:216/596 - (36%) Gaps:184/596 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VDLGVACLVCLAEEPEASSIYGHDPESPHMLILDKIRCCTSLQLDSSPSQLQRWPDKICKQCHLE 74
            :|:...||.||:......|||.....|   .:.|.||..|.    :.|.:....|:|:|..|..|
  Fly     1 MDVDKICLTCLSSTGPLLSIYDGGSGS---CLADMIREFTK----TKPRRNDNLPEKVCLSCLSE 58

  Fly    75 LSVSYRFHEKC----TAVQKLFRSASRSTSTSAVFAAAAAAPPAPMLVDKQQEQLKLDLEQAHVR 135
            :|..|.|..||    ..:::|..:|......|.|   :.:.|.|......|....:.|...|.|:
  Fly    59 ISNCYTFKIKCENSSRTLRQLLPNALPEEPDSKV---SISCPVATTDQAVQTTSWEPDRCTASVQ 120

  Fly   136 LPATLKIRRLNVEPCSSSSVSGTITTSTE------------PSEDVKEEKTDSLSLIPDGAMVLS 188
            ..|   :...:.|. ::|.:..||:...:            |.|.|  |||.||.|...|    :
  Fly   121 TDA---VTTTDAEQ-NTSLIKSTISVDLDYEGEGEVFDYELPDEPV--EKTTSLILQVQG----N 175

  Fly   189 LNDFQ----AQDSITQQAEEKDPKKQ------------QDEDE-------------GQAKMLELD 224
            |.|.:    .|.::..:.::.:.::|            .:|.|             ..||:|...
  Fly   176 LKDEKEVVFTQTNVIYEGDDHELEQQIRECNLAIFEGVDNEAEIITVTAPQVTTRKSAAKLLTQQ 240

  Fly   225 PWDDENTP----EHLYEIETP--------------LIEESVVASPPL---PLPPTHPANQQKKRT 268
            ..|...||    |...|:|..              ::::.|.|:||.   |.|..|....|:|.:
  Fly   241 ENDKHQTPVGSKEEARELEKEQVPQSAKRTSRRRGVVKQDVPATPPSDAEPSPKQHRLGTQRKLS 305

  Fly   269 YRR--------------VSPNVK------------------HEKLTANVDDDFKAGSTTK----- 296
            ..|              .:|.:|                  |.:....::.::|.....|     
  Fly   306 APRAGTVNGPSTTSGAATTPELKYHCDRCNAGFAVEKSLMIHRRQKGCINRNYKCNECEKVFVSP 370

  Fly   297 ------------------------------------RRN-------CER---------------- 302
                                                :||       |::                
  Fly   371 DHLAEHQASHGAHNCPECGIRCDSKEALSKHMVQGHKRNLRNQCNICQKVFTMLSTLRDHMRIHT 435

  Fly   303 --SPKICDVCGNTYKYQHALNAHMRRHNNERPYSCEVCQKAFISNVELRRHMRVHTGQKPYSCRH 365
              .|.:|::||.::.....|..|..||:..:.:.||:|..:|::..||..|.|.|||.||:.|..
  Fly   436 GEKPFVCNICGKSFTQNANLRQHKLRHSETKSFKCELCPHSFVTKAELTSHARTHTGDKPFECEV 500

  Fly   366 CERRFSDFGSSKKHERIHTGERPYVCEVCNKGFAYAHVLSAHRRTHTGKKQFQCTQCDKGFTKKT 430
            |..||:...|..||:|.|||||||.|::|...|...:||..|||||||::.:.|..|.|.||::.
  Fly   501 CLARFTTSCSLAKHKRKHTGERPYACDLCPMRFTALNVLKNHRRTHTGERPYVCPFCSKTFTQRG 565

  Fly   431 YLSAHMEQHRG 441
            ....|...|:|
  Fly   566 DCQMHQRTHQG 576

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9215NP_573045.1 zf-AD 16..92 CDD:285071 23/79 (29%)
DUF2117 165..>273 CDD:303038 35/171 (20%)
COG5048 <303..439 CDD:227381 54/135 (40%)
C2H2 Zn finger 307..327 CDD:275368 5/19 (26%)
zf-H2C2_2 319..344 CDD:290200 8/24 (33%)
zf-C2H2 333..355 CDD:278523 8/21 (38%)
C2H2 Zn finger 335..355 CDD:275368 8/19 (42%)
zf-H2C2_2 347..371 CDD:290200 12/23 (52%)
C2H2 Zn finger 363..383 CDD:275368 8/19 (42%)
zf-H2C2_2 375..400 CDD:290200 14/24 (58%)
C2H2 Zn finger 391..411 CDD:275368 8/19 (42%)
zf-H2C2_2 404..427 CDD:290200 11/22 (50%)
C2H2 Zn finger 419..439 CDD:275368 6/19 (32%)
CG6654NP_650429.1 zf-AD 6..79 CDD:285071 23/79 (29%)
C2H2 Zn finger 331..354 CDD:275368 1/22 (5%)
COG5048 <357..570 CDD:227381 58/212 (27%)
C2H2 Zn finger 360..380 CDD:275368 1/19 (5%)
C2H2 Zn finger 385..406 CDD:275370 0/20 (0%)
C2H2 Zn finger 414..434 CDD:275368 1/19 (5%)
zf-H2C2_2 427..451 CDD:290200 4/23 (17%)
C2H2 Zn finger 442..490 CDD:275368 15/47 (32%)
C2H2 Zn finger 470..487 CDD:275368 6/16 (38%)
zf-H2C2_2 482..507 CDD:290200 13/24 (54%)
C2H2 Zn finger 498..518 CDD:275368 8/19 (42%)
zf-H2C2_2 510..534 CDD:290200 13/23 (57%)
C2H2 Zn finger 526..546 CDD:275368 8/19 (42%)
zf-H2C2_2 539..563 CDD:290200 12/23 (52%)
C2H2 Zn finger 554..574 CDD:275368 6/19 (32%)
C2H2 Zn finger 582..602 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.