DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9215 and Zfp281

DIOPT Version :9

Sequence 1:NP_573045.1 Gene:CG9215 / 32494 FlyBaseID:FBgn0030659 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_001012030.1 Gene:Zfp281 / 305083 RGDID:1305139 Length:889 Species:Rattus norvegicus


Alignment Length:427 Identity:99/427 - (23%)
Similarity:157/427 - (36%) Gaps:94/427 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 STSTSAVFAAAAAAPPAPMLVDKQQEQLKLDLEQAHVRLPATLKIRRLNVEPCSSSSVSGTITTS 162
            |:||||..||....||||.:..|:                          ||.:|::...:..||
  Rat    73 SSSTSAAPAAEPPPPPAPDMTFKK--------------------------EPAASAAAFPSQRTS 111

  Fly   163 ---TEPSEDVKEEKTDSLSLIPDGAMVLSLNDFQAQDSITQQAEEKDPKKQQDEDEGQAKMLELD 224
               .:....:|:||...    |:.......:.......:...|||:.|.....|......:.:| 
  Rat   112 WGFLQSLVSIKQEKPAD----PEEQQSHHHHHHHHYGGLFAGAEERSPGLGGGEGGSHGVIQDL- 171

  Fly   225 PWDDENTPEHLYEIETPLIEESVVASPPLPLPPTHPANQQKKRTYRRVSPNVKHEKLTANVDDDF 289
                ....:|:.: :.......|:.|........|...:.|:.|      |||..|.........
  Rat   172 ----SILHQHVQQ-QPAQHHRDVLLSSSGSRTDDHGNEEPKQDT------NVKKAKRPKPESQGI 225

  Fly   290 KAGSTTKRR-----------------NCERSPKICDVCGNTYKYQHALNAHMRRHNNERPYSCEV 337
            ||    ||:                 :..:.|.|||.|...::..:.|..|:..|..|||:.|..
  Rat   226 KA----KRKPSASSKPLVGEGEGAVLSPSQKPHICDHCSAAFRSSYHLRRHVLIHTGERPFQCSQ 286

  Fly   338 CQKAFISNVELRRHMRVHTGQKPYSCRHCERRFSDFGSSKKHERIHTGERPYVCEVCNKGFAYAH 402
            |...||....|:||.::|:.:||:.|..|..:|......::|:|.|:||:||.|:.|.:.|:...
  Rat   287 CSMGFIQKYLLQRHEKIHSREKPFGCDQCSMKFIQKYHMERHKRTHSGEKPYKCDTCQQYFSRTD 351

  Fly   403 VLSAHRRTHTGKKQFQCTQCDKGFTKKTYLSAHMEQHRGSGN----GEASVASSSADASSRNQNA 463
            .|..||||           |.:...|.   :|..|.  ||.|    |..:|.|....:|||.::.
  Rat   352 RLLKHRRT-----------CGEAIAKG---AASAEP--GSSNHNNMGNLAVLSQGNTSSSRRKSK 400

  Fly   464 S--------ARKESARKQQQIPESFSLDSVELEQTKV 492
            |        ..|.....:.|:..:.::.|..:|...|
  Rat   401 SKSIAVENKEHKTGKTNESQMSNNINMQSYSVEMPTV 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9215NP_573045.1 zf-AD 16..92 CDD:285071
DUF2117 165..>273 CDD:303038 16/107 (15%)
COG5048 <303..439 CDD:227381 43/135 (32%)
C2H2 Zn finger 307..327 CDD:275368 5/19 (26%)
zf-H2C2_2 319..344 CDD:290200 9/24 (38%)
zf-C2H2 333..355 CDD:278523 7/21 (33%)
C2H2 Zn finger 335..355 CDD:275368 7/19 (37%)
zf-H2C2_2 347..371 CDD:290200 8/23 (35%)
C2H2 Zn finger 363..383 CDD:275368 5/19 (26%)
zf-H2C2_2 375..400 CDD:290200 10/24 (42%)
C2H2 Zn finger 391..411 CDD:275368 7/19 (37%)
zf-H2C2_2 404..427 CDD:290200 6/22 (27%)
C2H2 Zn finger 419..439 CDD:275368 4/19 (21%)
Zfp281NP_001012030.1 zf-C2H2_4 254..276 CDD:404733 6/21 (29%)
C2H2 Zn finger 256..276 CDD:275368 5/19 (26%)
zf-H2C2_2 268..293 CDD:404364 9/24 (38%)
C2H2 Zn finger 284..304 CDD:275368 7/19 (37%)
C2H2 Zn finger 312..332 CDD:275368 5/19 (26%)
zf-H2C2_2 324..349 CDD:404364 10/24 (42%)
C2H2 Zn finger 340..359 CDD:275368 6/18 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24404
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.