DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9215 and ZNF740

DIOPT Version :9

Sequence 1:NP_573045.1 Gene:CG9215 / 32494 FlyBaseID:FBgn0030659 Length:560 Species:Drosophila melanogaster
Sequence 2:XP_006719407.1 Gene:ZNF740 / 283337 HGNCID:27465 Length:207 Species:Homo sapiens


Alignment Length:175 Identity:47/175 - (26%)
Similarity:80/175 - (45%) Gaps:34/175 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 ANQQKKRTYRRVSPNV----------KHEKLTANVDDDFKAGSTTKRRNCERSPKICDVCGNTYK 315
            |::|.:...|..||:|          ..:|..:..|||    |.::..:.:::.|...|......
Human    32 ASKQAENGERAGSPDVLRCSSQGHRKDSDKSRSRKDDD----SLSEASHSKKTVKKVVVVEQNGS 92

  Fly   316 YQHALNAHMRRHNNERPYSCEVCQKAFISNVELRRHMRVHTGQKPYSCRHCERRFSDFGSSKKHE 380
            :|..:         .:.:.||.|..||.|:..|:||:.:|||:||:.|..|:.||......::|:
Human    93 FQVKI---------PKNFVCEHCFGAFRSSYHLKRHILIHTGEKPFECDICDMRFIQKYHLERHK 148

  Fly   381 RIHTGERPYVCEVCNKGFAYAHVLSAHRRTHTGKKQFQCTQCDKG 425
            |:|:||:||.||.|::           .:..||.|.......:||
Human   149 RVHSGEKPYQCERCHQ-----------EQPKTGPKLANSCSRNKG 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9215NP_573045.1 zf-AD 16..92 CDD:285071
DUF2117 165..>273 CDD:303038 3/11 (27%)
COG5048 <303..439 CDD:227381 36/123 (29%)
C2H2 Zn finger 307..327 CDD:275368 2/19 (11%)
zf-H2C2_2 319..344 CDD:290200 5/24 (21%)
zf-C2H2 333..355 CDD:278523 9/21 (43%)
C2H2 Zn finger 335..355 CDD:275368 9/19 (47%)
zf-H2C2_2 347..371 CDD:290200 11/23 (48%)
C2H2 Zn finger 363..383 CDD:275368 6/19 (32%)
zf-H2C2_2 375..400 CDD:290200 10/24 (42%)
C2H2 Zn finger 391..411 CDD:275368 3/19 (16%)
zf-H2C2_2 404..427 CDD:290200 5/22 (23%)
C2H2 Zn finger 419..439 CDD:275368 2/7 (29%)
ZNF740XP_006719407.1 COG5048 96..>178 CDD:227381 31/101 (31%)
C2H2 Zn finger 103..123 CDD:275368 9/19 (47%)
zf-H2C2_2 115..140 CDD:290200 12/24 (50%)
C2H2 Zn finger 131..151 CDD:275368 6/19 (32%)
zf-H2C2_2 143..>163 CDD:290200 9/19 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24404
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.