DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9215 and ace2

DIOPT Version :9

Sequence 1:NP_573045.1 Gene:CG9215 / 32494 FlyBaseID:FBgn0030659 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_594109.1 Gene:ace2 / 2541661 PomBaseID:SPAC6G10.12c Length:533 Species:Schizosaccharomyces pombe


Alignment Length:491 Identity:85/491 - (17%)
Similarity:167/491 - (34%) Gaps:193/491 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LDSSPSQLQRWPDK-----ICKQCH---LELSVSYRFHEKCTAVQKLFRSASRSTSTSAVFAAAA 109
            :.|.||.||.:.|:     :.|...   ||.:.:|....:.        |...|.|.::.|.|:.
pombe    61 IPSPPSHLQNFQDQFDYSSVLKTPFNPLLEANSAYFLSNQI--------SLPDSHSYASSFDASL 117

  Fly   110 AAPPAPM-------------------LVDKQQ--EQL---------KLDLEQAHVRLPATLKIRR 144
            :.|.:|:                   |.:.||  .::         :||.:|..:..| ...|..
pombe   118 SPPSSPLTCVSQIHTEQNFNNNDAFSLTNSQQAFSEIGYDASNWIDELDSQQQVLSFP-EFDIPE 181

  Fly   145 LNVEPCSSSS-------VSGTITTSTEPSEDVKEEKTDSLSLIPDGAMVLSLNDFQAQDSITQQA 202
            :..|.||:..       :|.:|..::.|:.          |::|..:.:.|.|:|....|     
pombe   182 IKTETCSNKDHLENFDYLSSSIPETSGPAS----------SVLPSSSQLESFNEFMFLPS----- 231

  Fly   203 EEKDPKKQQDEDEGQAKMLELDPWDDENTPEHLYEIETPLIEESVVASPPLP------LPPTHP- 260
                .....||..|.....||:....:.:|.|..::.:|  |.:...||..|      |.||.| 
pombe   232 ----SPPGLDEINGAPSFEELNFQISQPSPAHPVDLSSP--ETAPNISPVSPFAQLVKLEPTSPQ 290

  Fly   261 ----------------ANQQKKRTYRRVSPNVKH----EKLT-----------ANVDD------- 287
                            .:...::.:.::|...::    ||.:           ||:::       
pombe   291 KPSFALDSSFSHLDVCRHTDNQKAFAKLSSPAEYVSEFEKFSSVCDHGLDISNANINNTLTQQFA 355

  Fly   288 ---DFKAGSTTKR------------------------------------------RNC---ERSP 304
               .:::...||:                                          ..|   ::|.
pombe   356 LSAPYESCIVTKKPEPCITVKEEEQLAPKIESADLSITPQVTEHDSKPPVRISYDHRCKTRKQST 420

  Fly   305 KICDV------------------------CGNTYKYQHALNAHMRRHNNERPYSCEVCQKAFISN 345
            :||.:                        |......::.:.:|::.|.::|||.|::|:..|:.:
pombe   421 RICRIPPETMASLYCGPEADGKYVCLYNGCNKRIARKYNVESHIQTHLSDRPYRCDLCKAGFVRH 485

  Fly   346 VELRRHMRVHTGQKPYSCRHCERRFSDFGSSKKHER 381
            .:|:||:|:|...:||.| .|.:||:...:..:|::
pombe   486 HDLKRHLRIHENGRPYVC-ECLKRFNRLDALNRHKQ 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9215NP_573045.1 zf-AD 16..92 CDD:285071 10/46 (22%)
DUF2117 165..>273 CDD:303038 23/130 (18%)
COG5048 <303..439 CDD:227381 24/103 (23%)
C2H2 Zn finger 307..327 CDD:275368 3/43 (7%)
zf-H2C2_2 319..344 CDD:290200 8/24 (33%)
zf-C2H2 333..355 CDD:278523 8/21 (38%)
C2H2 Zn finger 335..355 CDD:275368 7/19 (37%)
zf-H2C2_2 347..371 CDD:290200 10/23 (43%)
C2H2 Zn finger 363..383 CDD:275368 5/19 (26%)
zf-H2C2_2 375..400 CDD:290200 1/7 (14%)
C2H2 Zn finger 391..411 CDD:275368
zf-H2C2_2 404..427 CDD:290200
C2H2 Zn finger 419..439 CDD:275368
ace2NP_594109.1 COG5048 45..518 CDD:227381 84/487 (17%)
C2H2 Zn finger 448..467 CDD:275368 2/18 (11%)
zf-C2H2 473..495 CDD:278523 8/21 (38%)
C2H2 Zn finger 475..495 CDD:275368 7/19 (37%)
zf-H2C2_2 487..511 CDD:290200 11/24 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.