DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9215 and ZSCAN4

DIOPT Version :9

Sequence 1:NP_573045.1 Gene:CG9215 / 32494 FlyBaseID:FBgn0030659 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_001371762.1 Gene:ZSCAN4 / 201516 HGNCID:23709 Length:433 Species:Homo sapiens


Alignment Length:400 Identity:106/400 - (26%)
Similarity:162/400 - (40%) Gaps:75/400 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 DSSPS----QLQR-------W--PDKICKQCHLELSVSYRF------HEKCTAVQKLFRSASRST 99
            ||:.|    :|||       |  |:|..|...:.|.|..:|      ::|.:..:|...|.....
Human    52 DSNNSYARQELQRLYRIFHSWLQPEKHSKDEIISLLVLEQFMIGGHCNDKASVKEKWKSSGKNLE 116

  Fly   100 STSAVFAAAAAAPPAPMLVDKQ-QEQL---KLDLEQAHVRLPATLKIRRLNVEPCSSSSVSGTIT 160
            .........:..|||.:.|..| ||.|   .:.|....|.|     .:::|.:....:::.    
Human   117 RFIEDLTDDSINPPALVHVHMQGQEALFSEDMPLRDVIVHL-----TKQVNAQTTREANMG---- 172

  Fly   161 TSTEPSEDVKEEKTDSLSLIPDGAMVLSLNDFQAQDSITQQA----------EEKDPKKQQ---- 211
            |.::.|:|...|.........|| ...|....:..::||.|.          ||..|:.::    
Human   173 TPSQTSQDTSLETGQGYEDEQDG-WNSSSKTTRVNENITNQGNQIVSLIIIQEENGPRPEEGGVS 236

  Fly   212 DEDEGQAKMLEL-DPWDDENTPEHLYEIETPLIEESVVASPPLPLPP----THPANQQKKRTYRR 271
            .::...:|..|| .....|.:...:.....|::..:...|.|....|    ||.:|:..      
Human   237 SDNPYNSKRAELVTARSQEGSINGITFQGVPMVMGAGCISQPEQSSPESALTHQSNEGN------ 295

  Fly   272 VSPNVKHEKLTANVDDDFKAGSTTKRRNCERSPKICDVCGNTYKYQHALNAHMRRHNNERPYSCE 336
             |....|:|.:..|...:|         ||..||:       :||...|.||.|||.||||:.|.
Human   296 -STCEVHQKGSHGVQKSYK---------CEECPKV-------FKYLCHLLAHQRRHRNERPFVCP 343

  Fly   337 VCQKAFISNVELRRHMRVHTGQKPYSCRHCERRFSDFGSSKKHERIHTGERPYVCEVCNKGFAYA 401
            .|||.|....:||.|..:|||:||::|..|::.||...:.:.||||||||:||.|..|...:..:
Human   344 ECQKGFFQISDLRVHQIIHTGKKPFTCSMCKKSFSHKTNLRSHERIHTGEKPYTCPFCKTSYRQS 408

  Fly   402 HVLSAHRRTH 411
            .....|.|||
Human   409 STYHRHMRTH 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9215NP_573045.1 zf-AD 16..92 CDD:285071 15/56 (27%)
DUF2117 165..>273 CDD:303038 23/126 (18%)
COG5048 <303..439 CDD:227381 46/108 (43%)
C2H2 Zn finger 307..327 CDD:275368 6/19 (32%)
zf-H2C2_2 319..344 CDD:290200 15/24 (63%)
zf-C2H2 333..355 CDD:278523 8/21 (38%)
C2H2 Zn finger 335..355 CDD:275368 8/19 (42%)
zf-H2C2_2 347..371 CDD:290200 10/23 (43%)
C2H2 Zn finger 363..383 CDD:275368 7/19 (37%)
zf-H2C2_2 375..400 CDD:290200 12/24 (50%)
C2H2 Zn finger 391..411 CDD:275368 4/19 (21%)
zf-H2C2_2 404..427 CDD:290200 3/7 (43%)
C2H2 Zn finger 419..439 CDD:275368
ZSCAN4NP_001371762.1 SCAN 40..124 CDD:153421 16/71 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..210 7/49 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 275..301 7/32 (22%)
zf-C2H2 312..334 CDD:395048 11/37 (30%)
C2H2 Zn finger 314..334 CDD:275368 10/26 (38%)
C2H2 Zn finger 342..362 CDD:275368 8/19 (42%)
zf-C2H2 368..390 CDD:395048 7/21 (33%)
C2H2 Zn finger 370..390 CDD:275368 7/19 (37%)
zf-H2C2_2 382..407 CDD:404364 12/24 (50%)
C2H2 Zn finger 398..418 CDD:275368 4/19 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.