Sequence 1: | NP_573045.1 | Gene: | CG9215 / 32494 | FlyBaseID: | FBgn0030659 | Length: | 560 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001245209.1 | Gene: | ZNF501 / 115560 | HGNCID: | 23717 | Length: | 271 | Species: | Homo sapiens |
Alignment Length: | 219 | Identity: | 75/219 - (34%) |
---|---|---|---|
Similarity: | 112/219 - (51%) | Gaps: | 19/219 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 293 STTKRRNCER--SPKICDVCGNTYKYQHALNAHMRRHNNERPYSCEVCQKAFISNVELRRHMRVH 355
Fly 356 TGQKPYSCRHCERRFSDFGSSKKHERIHTGERPYVCEVCNKGFAYAHVLSAHRRTHTGKKQFQCT 420
Fly 421 QCDKGFTKKTYLSAHMEQHRG------SGNGEASVASSSADASSRNQ------NASARKESARKQ 473
Fly 474 QQIPESFSLDSVELEQTKVLEECI 497 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9215 | NP_573045.1 | zf-AD | 16..92 | CDD:285071 | |
DUF2117 | 165..>273 | CDD:303038 | |||
COG5048 | <303..439 | CDD:227381 | 57/135 (42%) | ||
C2H2 Zn finger | 307..327 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 319..344 | CDD:290200 | 12/24 (50%) | ||
zf-C2H2 | 333..355 | CDD:278523 | 9/21 (43%) | ||
C2H2 Zn finger | 335..355 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 347..371 | CDD:290200 | 11/23 (48%) | ||
C2H2 Zn finger | 363..383 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 375..400 | CDD:290200 | 15/24 (63%) | ||
C2H2 Zn finger | 391..411 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 404..427 | CDD:290200 | 10/22 (45%) | ||
C2H2 Zn finger | 419..439 | CDD:275368 | 6/19 (32%) | ||
ZNF501 | NP_001245209.1 | COG5048 | <20..256 | CDD:227381 | 75/219 (34%) |
C2H2 Zn finger | 24..44 | CDD:275368 | 2/7 (29%) | ||
C2H2 Zn finger | 52..72 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 64..87 | CDD:290200 | 10/22 (45%) | ||
C2H2 Zn finger | 80..100 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 93..115 | CDD:290200 | 11/21 (52%) | ||
C2H2 Zn finger | 108..128 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 120..145 | CDD:290200 | 15/24 (63%) | ||
C2H2 Zn finger | 136..156 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 149..173 | CDD:290200 | 11/23 (48%) | ||
C2H2 Zn finger | 164..184 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 177..201 | CDD:290200 | 6/23 (26%) | ||
C2H2 Zn finger | 192..212 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 220..240 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 232..257 | CDD:290200 | 4/23 (17%) | ||
C2H2 Zn finger | 248..268 | CDD:275368 | 1/2 (50%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24404 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |