DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7872 and zgc:122979

DIOPT Version :9

Sequence 1:NP_573044.1 Gene:CG7872 / 32493 FlyBaseID:FBgn0030658 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001032663.2 Gene:zgc:122979 / 641576 ZFINID:ZDB-GENE-051127-45 Length:360 Species:Danio rerio


Alignment Length:64 Identity:32/64 - (50%)
Similarity:44/64 - (68%) Gaps:4/64 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 YDVLGVTRESSKSEIGKAYRQLARRYHPDLHRGAEAKAAAETQFKLVATAYEILRDEESRTDYD 96
            |.||||:.:|::.||.|||::||.|||||.:..|:    ||.:||.:|.||::|.|.|.|..||
Zfish    53 YSVLGVSNDSNEEEIRKAYKRLALRYHPDKNSDAD----AEDKFKQIAQAYDVLTDPEKRNIYD 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7872NP_573044.1 DnaJ 31..96 CDD:278647 30/62 (48%)
zgc:122979NP_001032663.2 DnaJ 50..355 CDD:223560 32/64 (50%)
DnaJ 51..112 CDD:278647 30/62 (48%)
DnaJ_C 185..345 CDD:199909
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.