powered by:
Protein Alignment CG7872 and zgc:122979
DIOPT Version :9
Sequence 1: | NP_573044.1 |
Gene: | CG7872 / 32493 |
FlyBaseID: | FBgn0030658 |
Length: | 333 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001032663.2 |
Gene: | zgc:122979 / 641576 |
ZFINID: | ZDB-GENE-051127-45 |
Length: | 360 |
Species: | Danio rerio |
Alignment Length: | 64 |
Identity: | 32/64 - (50%) |
Similarity: | 44/64 - (68%) |
Gaps: | 4/64 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 33 YDVLGVTRESSKSEIGKAYRQLARRYHPDLHRGAEAKAAAETQFKLVATAYEILRDEESRTDYD 96
|.||||:.:|::.||.|||::||.|||||.:..|: ||.:||.:|.||::|.|.|.|..||
Zfish 53 YSVLGVSNDSNEEEIRKAYKRLALRYHPDKNSDAD----AEDKFKQIAQAYDVLTDPEKRNIYD 112
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG7872 | NP_573044.1 |
DnaJ |
31..96 |
CDD:278647 |
30/62 (48%) |
zgc:122979 | NP_001032663.2 |
DnaJ |
50..355 |
CDD:223560 |
32/64 (50%) |
DnaJ |
51..112 |
CDD:278647 |
30/62 (48%) |
DnaJ_C |
185..345 |
CDD:199909 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.