DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7872 and Dnajb12

DIOPT Version :9

Sequence 1:NP_573044.1 Gene:CG7872 / 32493 FlyBaseID:FBgn0030658 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001361685.1 Gene:Dnajb12 / 56709 MGIID:1931881 Length:378 Species:Mus musculus


Alignment Length:321 Identity:75/321 - (23%)
Similarity:119/321 - (37%) Gaps:98/321 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 YDVLGVTRESSKSEIGKAYRQLARRYHPDLHRGAEAKAAAETQFKLVATAYEILRDEESRTDYDY 97
            |::|||:|.:|..::.||||:||.::|||.:....|..|    ||.:.|||.:|.:.|.|..||.
Mouse   113 YEILGVSRSASDEDLKKAYRKLALKFHPDKNHAPGATEA----FKAIGTAYAVLSNPEKRKQYDQ 173

  Fly    98 MLDNPD--AYYAH----YYRYYRRRVAPKVDVRVVIVVVLTIVSVIQYYSGWQRYDSAIKYFATV 156
            ..|:..  |.:.|    ::|.:...::|:....:.........:|..|.:|..||          
Mouse   174 FGDDKSQAARHGHSHGDFHRGFEADISPEDLFNMFFGGGFPSSNVHVYSNGRMRY---------- 228

  Fly   157 PKYRNQALEIARDEIQEKIQKKGKNRMSKNDQRDELERIIRRVIEEKMDVKGGYAKPTLWDVLWV 221
                                    ....:.|:||.             ...||..       ::|
Mouse   229 ------------------------TYQQRQDRRDN-------------QGDGGLG-------VFV 249

  Fly   222 QLIICPYTILSFIVWHAQWFWRYTVMKQPYG---REQKLYLIRR---HLGMGQHQFEAQEDKLIE 280
            ||:  |..||..:...:|    ..|...||.   |....::.:|   ||.:..:    ..|...|
Mouse   250 QLM--PILILILVSALSQ----LMVSSPPYSLSPRPSVGHIHKRVTDHLNVAYY----VADTFSE 304

  Fly   281 EYL--HLKLWKR---ENFVA------WKAEQEEEMKKKLAENPRY----KAYRRYMKNHGP 326
            ||.  .||..:|   ::::|      ||   |::.|:.|....||    ..|.|..|...|
Mouse   305 EYTGSSLKTVERNVEDDYIANLRNNCWK---EKQQKEGLLYRARYFGDTDMYHRAQKMGTP 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7872NP_573044.1 DnaJ 31..96 CDD:278647 25/62 (40%)
Dnajb12NP_001361685.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..97
DnaJ_bact 111..>237 CDD:274090 38/161 (24%)
DUF1977 269..369 CDD:370429 25/101 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.