powered by:
Protein Alignment CG7872 and Dnajb5
DIOPT Version :9
Sequence 1: | NP_573044.1 |
Gene: | CG7872 / 32493 |
FlyBaseID: | FBgn0030658 |
Length: | 333 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001342367.1 |
Gene: | Dnajb5 / 56323 |
MGIID: | 1930018 |
Length: | 420 |
Species: | Mus musculus |
Alignment Length: | 69 |
Identity: | 28/69 - (40%) |
Similarity: | 46/69 - (66%) |
Gaps: | 5/69 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 28 GKENCYDVLGVTRESSKSEIGKAYRQLARRYHPDLHRGAEAKAAAETQFKLVATAYEILRDEESR 92
||: .|.:||:...:::.||.||||::|.:||||.:: :..||.:||.:|.||::|.|.:.|
Mouse 74 GKD-YYKILGIPSGANEDEIKKAYRKMALKYHPDKNK----EPNAEEKFKEIAEAYDVLSDPKKR 133
Fly 93 TDYD 96
:.||
Mouse 134 SLYD 137
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG7872 | NP_573044.1 |
DnaJ |
31..96 |
CDD:278647 |
24/64 (38%) |
Dnajb5 | NP_001342367.1 |
DnaJ |
72..415 |
CDD:223560 |
28/69 (41%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.