DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7872 and dnajc16l

DIOPT Version :9

Sequence 1:NP_573044.1 Gene:CG7872 / 32493 FlyBaseID:FBgn0030658 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_021335369.1 Gene:dnajc16l / 556590 ZFINID:ZDB-GENE-130530-696 Length:789 Species:Danio rerio


Alignment Length:336 Identity:74/336 - (22%)
Similarity:130/336 - (38%) Gaps:119/336 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 YDVLGVTRESSKSEIGKAYRQLARRYHPDLHRGAEAKAAAETQFKLVATAYEILRDEESRTDYD- 96
            |.||||::.:|.:||.|.|::|||.:|||.::    ...||..|..:..:||||.:||.|.:|| 
Zfish    38 YSVLGVSKHASLTEIKKMYKKLAREWHPDKNK----SPGAEDMFIKITKSYEILSNEERRANYDR 98

  Fly    97 --YMLDNPDAYYAHYYRYYRRRVAPKVDVRVVIVVVLTIVSVIQYYSGWQRYDSAIKYFATVPKY 159
              .|.:|.:  :|...:.:|                       ||:..:. :|.:..:|   |: 
Zfish    99 FGQMDENQN--FARPPQGFR-----------------------QYHDSFY-FDESFFHF---PR- 133

  Fly   160 RNQALEIARDEIQEKIQKKGKNRMSKNDQRDELERIIRRVIEEKMDVKGGYAKPTLWDVL--WVQ 222
                  .:||..:      .|:.:..|...:|:             :...:.:|.|..:.  |  
Zfish   134 ------TSRDFTE------SKHLLHYNQYMNEV-------------LPDSFKRPYLIKITSEW-- 171

  Fly   223 LIICPYTILSFIVWHAQWFWRYTVMK-QP---------YGREQKLYLIRRHLGMGQ--------- 268
               |      |...|.:..|:.||:: :|         .|.|::|   ..|||..:         
Zfish   172 ---C------FTCIHIEPIWKDTVLELEPLGVGIGVVDIGYERQL---ANHLGAHRTPSILGLVN 224

  Fly   269 ------HQFEAQED--KLIEEYLHLKLWKR---ENFVAWKAEQEEEMKKK-----LAENP--RYK 315
                  |....:|.  :.:|..|..:|.::   .|::.:.....||.|.:     :|.|.  .||
Zfish   225 GKVTFFHYSVVREHLRQFVESLLPQRLVEKVTDSNYLEFLNSWHEENKPRVIMFDIASNVPLLYK 289

  Fly   316 ----AYRRYMK 322
                ||:.|::
Zfish   290 LTAFAYKDYVR 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7872NP_573044.1 DnaJ 31..96 CDD:278647 26/62 (42%)
dnajc16lXP_021335369.1 DnaJ 36..>136 CDD:333066 37/137 (27%)
TRX_DnaJ 137..246 CDD:239261 23/141 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.