powered by:
Protein Alignment CG7872 and DNAJA4
DIOPT Version :9
Sequence 1: | NP_573044.1 |
Gene: | CG7872 / 32493 |
FlyBaseID: | FBgn0030658 |
Length: | 333 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_061072.3 |
Gene: | DNAJA4 / 55466 |
HGNCID: | 14885 |
Length: | 426 |
Species: | Homo sapiens |
Alignment Length: | 64 |
Identity: | 30/64 - (46%) |
Similarity: | 39/64 - (60%) |
Gaps: | 6/64 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 33 YDVLGVTRESSKSEIGKAYRQLARRYHPDLHRGAEAKAAAETQFKLVATAYEILRDEESRTDYD 96
||:|||...:|..||.||||:||.:||||.:.....| |||::.|||:|.|.:.|..||
Human 37 YDILGVKPSASPEEIKKAYRKLALKYHPDKNPDEGEK------FKLISQAYEVLSDPKKRDVYD 94
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.