DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7872 and DNAJC25-GNG10

DIOPT Version :9

Sequence 1:NP_573044.1 Gene:CG7872 / 32493 FlyBaseID:FBgn0030658 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_004116.2 Gene:DNAJC25-GNG10 / 552891 HGNCID:37501 Length:153 Species:Homo sapiens


Alignment Length:107 Identity:50/107 - (46%)
Similarity:67/107 - (62%) Gaps:13/107 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVLLALLPTMAL-----GLLEGLYCGKENCYDVLGVTRESSKSEIGKAYRQLARRYHPDLHR--- 64
            ::|..|||.:.|     .|:||||||..:||:||||:|.:.|:||.:||||||||||||.:|   
Human    21 MLLAPLLPALLLVRPAGALVEGLYCGTRDCYEVLGVSRSAGKAEIARAYRQLARRYHPDRYRPQP 85

  Fly    65 GAEAKA----AAETQFKLVATAYEILRDEESRTD-YDYMLDN 101
            |.|...    :||..|.|||||||.|:..::..: ..|.:.|
Human    86 GDEGPGRTPQSAEEAFLLVATAYETLKVSQAAAELQQYCMQN 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7872NP_573044.1 DnaJ 31..96 CDD:278647 36/72 (50%)
DNAJC25-GNG10NP_004116.2 DnaJ 49..112 CDD:278647 35/62 (56%)
GGL 92..148 CDD:238024 13/36 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157765
Domainoid 1 1.000 273 1.000 Domainoid score I1804
eggNOG 1 0.900 - - E2759_KOG0722
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 370 1.000 Inparanoid score I2139
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57734
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005688
OrthoInspector 1 1.000 - - oto89995
orthoMCL 1 0.900 - - OOG6_105648
Panther 1 1.100 - - LDO PTHR44176
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2492
SonicParanoid 1 1.000 - - X4678
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1312.830

Return to query results.
Submit another query.