DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7872 and DNAJB12

DIOPT Version :9

Sequence 1:NP_573044.1 Gene:CG7872 / 32493 FlyBaseID:FBgn0030658 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001352009.1 Gene:DNAJB12 / 54788 HGNCID:14891 Length:377 Species:Homo sapiens


Alignment Length:321 Identity:77/321 - (23%)
Similarity:120/321 - (37%) Gaps:98/321 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 YDVLGVTRESSKSEIGKAYRQLARRYHPDLHRGAEAKAAAETQFKLVATAYEILRDEESRTDYDY 97
            |::|||:|.:|..::.||||:||.::|||.:....|..|    ||.:.|||.:|.:.|.|..||.
Human   112 YEILGVSRGASDEDLKKAYRRLALKFHPDKNHAPGATEA----FKAIGTAYAVLSNPEKRKQYDQ 172

  Fly    98 MLDNPD--AYYAH----YYRYYRRRVAPKVDVRVVIVVVLTIVSVIQYYSGWQRYDSAIKYFATV 156
            ..|:..  |.:.|    ::|.:...::|:....:.........:|..|.:|..||          
Human   173 FGDDKSQAARHGHGHGDFHRGFEADISPEDLFNMFFGGGFPSSNVHVYSNGRMRY---------- 227

  Fly   157 PKYRNQALEIARDEIQEKIQKKGKNRMSKNDQRDELERIIRRVIEEKMDVKGGYAKPTLWDVLWV 221
                                    ....:.|:||.             ...||..       ::|
Human   228 ------------------------TYQQRQDRRDN-------------QGDGGLG-------VFV 248

  Fly   222 QLIICPYTILSFIVWHAQWFWRYTVMKQPYG---REQKLYLIRR---HLGMGQHQFEAQEDKLIE 280
            ||:  |..||..:...:|    ..|...||.   |....::.||   |||:..:    ..|...|
Human   249 QLM--PILILILVSALSQ----LMVSSPPYSLSPRPSVGHIHRRVTDHLGVVYY----VGDTFSE 303

  Fly   281 EYL--HLKLWKR---ENFVA------WKAEQEEEMKKKLAENPRY----KAYRRYMKNHGP 326
            ||.  .||..:|   ::::|      ||   |::.|:.|....||    ..|.|..|...|
Human   304 EYTGSSLKTVERNVEDDYIANLRNNCWK---EKQQKEGLLYRARYFGDTDMYHRAQKMGTP 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7872NP_573044.1 DnaJ 31..96 CDD:278647 25/62 (40%)
DNAJB12NP_001352009.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..92
DnaJ 110..>236 CDD:333066 38/161 (24%)
DUF1977 268..368 CDD:312722 27/101 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.