DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7872 and DNAJC10

DIOPT Version :9

Sequence 1:	NP_573044.1	Gene:	CG7872 / 32493	FlyBaseID:	FBgn0030658	Length:	333	Species:	Drosophila melanogaster
Sequence 2:	NP_061854.1	Gene:	DNAJC10 / 54431	HGNCID:	24637	Length:	793	Species:	Homo sapiens

Alignment Length:	113	Identity:	37/113 - (32%)
Similarity:	59/113 - (52%)	Gaps:	15/113 - (13%)

- Green bases have known domain annotations that are detailed below.

  Fly     7 RLVLLALLPTMALGLLEGLYCGKENCYDVLGVTRESSKSEIGKAYRQLARRYHPDLHRGAEAKAA 71
            |::|..|:..||:     |....::.|.:|||::.:|..||.:|:::||.:.|||.:..   ...
Human    16 RIILCFLIVYMAI-----LVGTDQDFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPN---NPN 72

  Fly    72 AETQFKLVATAYEILRDEESRTDYDY-----MLDNPDAYYA--HYYRY 112
            |...|..:..|||:|:||:.|..||.     :.||....|.  :||||
Human    73 AHGDFLKINRAYEVLKDEDLRKKYDKYGEKGLEDNQGGQYESWNYYRY 120

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7872	NP_573044.1	DnaJ	31..96	CDD:278647	22/64 (34%)
DNAJC10	NP_061854.1	DnaJ	34..>132	CDD:223560	31/90 (34%)
		PDI_a_ERdj5_N	129..229	CDD:239301
		Trxb 1	235..350
		Trxb 2	348..463
		PDI_a_ERdj5_C	453..550	CDD:239302
		PDI_a_ERdj5_C	556..663	CDD:239302
		PDI_a_ERdj5_C	670..775	CDD:239302
		Prevents secretion from ER. /evidence=ECO:0000255\|PROSITE-ProRule:PRU10138	790..793
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910