DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7872 and DNAJB11

DIOPT Version :9

Sequence 1:NP_573044.1 Gene:CG7872 / 32493 FlyBaseID:FBgn0030658 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_057390.1 Gene:DNAJB11 / 51726 HGNCID:14889 Length:358 Species:Homo sapiens


Alignment Length:387 Identity:87/387 - (22%)
Similarity:141/387 - (36%) Gaps:122/387 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVLLALLPTMALGLLEGLYCGKENCYDVLGVTRESSKSEIGKAYRQLARRYHPDLHRGAEAKAAA 72
            |:||.|:..:..|         .:.|.:|||.|.:|..:|.||||:||.:.|||  |..:...|.
Human    11 LLLLYLIGAVIAG---------RDFYKILGVPRSASIKDIKKAYRKLALQLHPD--RNPDDPQAQ 64

  Fly    73 ETQFKLVATAYEILRDEESRTDYD----------YMLDNPDAYYAHYY-----------RYYRRR 116
            | :|:.:..|||:|.|.|.|..||          :...:.| .::|::           |...|.
Human    65 E-KFQDLGAAYEVLSDSEKRKQYDTYGEEGLKDGHQSSHGD-IFSHFFGDFGFMFGGTPRQQDRN 127

  Fly   117 VAPKVDVRVVIVVVLTIVSVIQYYSGWQRYDSAIKYFATVPKYRNQALEI-------ARDEIQEK 174
            :....|:.|.:.|.|.     :.|:|         .|..|.:.:..|.:.       .|.|::..
Human   128 IPRGSDIIVDLEVTLE-----EVYAG---------NFVEVVRNKPVARQAPGKRKCNCRQEMRTT 178

  Fly   175 IQKKGKNRMSKNDQRDELERI----IRRVIEEKMD--VKGGYAKPTLWDVLWVQLIICPYT---- 229
            ....|:.:|::....||...:    ..|.:|.:::  |:.|...|.:.:..       |:.    
Human   179 QLGPGRFQMTQEVVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGE-------PHVDGEP 236

  Fly   230 -ILSFIVWHAQWFWRYTVMKQPY--GREQKLY------LIRRHLG-------MGQHQFEAQEDKL 278
             .|.|         |..|:|.|.  .|...||      |:...:|       :..|:.....||:
Human   237 GDLRF---------RIKVVKHPIFERRGDDLYTNVTISLVESLVGFEMDITHLDGHKVHISRDKI 292

  Fly   279 IEEYLHLKLWKR----ENF--------------VAWKAEQ-----EEEMKKKLAENPRYKAY 317
            ...  ..||||:    .||              |.:..||     .|.:|:.|.:....|.|
Human   293 TRP--GAKLWKKGEGLPNFDNNNIKGSLIITFDVDFPKEQLTEEAREGIKQLLKQGSVQKVY 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7872NP_573044.1 DnaJ 31..96 CDD:278647 27/64 (42%)
DNAJB11NP_057390.1 DnaJ 22..344 CDD:223560 80/366 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.