DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7872 and dnajc3

DIOPT Version :9

Sequence 1:	NP_573044.1	Gene:	CG7872 / 32493	FlyBaseID:	FBgn0030658	Length:	333	Species:	Drosophila melanogaster
Sequence 2:	XP_012812335.1	Gene:	dnajc3 / 496977	XenbaseID:	XB-GENE-997043	Length:	504	Species:	Xenopus tropicalis

Alignment Length:	89	Identity:	35/89 - (39%)
Similarity:	54/89 - (60%)	Gaps:	6/89 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly    29 KENCYDVLGVTRESSKSEIGKAYRQLARRYHPDLHRGAEAKAAAETQFKLVATAYEILRDEESRT 93
            |.:.|.:|||.|.:.|.||.||||:||:::|||..:..|.|..||.:|..:|:|.|:|.|.|.|:
Frog   392 KRDYYKILGVKRNAKKQEIIKAYRKLAQQWHPDNFQDEEEKKKAEKKFIDIASAKEVLTDPEKRS 456

  Fly    94 DYDYMLD--NPDAYYA----HYYR 111
            .:|...|  :|::...    |::|
Frog   457 RFDAGEDPLDPESQQGAGGPHFHR 480

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7872	NP_573044.1	DnaJ	31..96	CDD:278647	29/64 (45%)
dnajc3	XP_012812335.1	TPR repeat	37..65	CDD:276809
		PEP_TPR_lipo	47..>366	CDD:274350
		TPR repeat	70..100	CDD:276809
		TPR repeat	105..133	CDD:276809
		TPR repeat	154..182	CDD:276809
		TPR repeat	187..217	CDD:276809
		TPR repeat	222..250	CDD:276809
		TPR repeat	256..281	CDD:276809
		TPR repeat	300..335	CDD:276809
		TPR repeat	340..368	CDD:276809
		TPR repeat	374..397	CDD:276809	1/4 (25%)
		DnaJ	392..>494	CDD:223560	35/89 (39%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910