DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7872 and CG3061

DIOPT Version :9

Sequence 1:NP_573044.1 Gene:CG7872 / 32493 FlyBaseID:FBgn0030658 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster


Alignment Length:229 Identity:51/229 - (22%)
Similarity:90/229 - (39%) Gaps:77/229 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 YDVLGVTRESSKSEIGKAYRQLARRYHPDLHRGAEAKAAAETQFKLVATAYEILRDEESRTDYD- 96
            |:||||::.::.|||.|||::||.:.|||.::   |..|.|. ||.:..|..:|.|.|.|.:|| 
  Fly   108 YEVLGVSKTATDSEIKKAYKKLALQLHPDKNK---APGAVEA-FKALGNAAGVLTDAEKRKNYDL 168

  Fly    97 YML--------DNPDAYYAH--YY-----------------------------------RYYRRR 116
            |.:        :|...::.|  ||                                   |..|||
  Fly   169 YGINESHNGHGNNGGGHHGHGQYYNNEYGYSRGFQADISAEELFNMFFNGGFPQQNVHMRQQRRR 233

  Fly   117 VAPKVD------------VRVVIVVVLTIVSVI----QYYSGWQRYDSAIK---------YFATV 156
            ...:.|            :.:|:::.|:::|..    ..||....:..::|         |:...
  Fly   234 QQAREDREGNNSSALVNLLPIVLLIGLSMMSSFFISDPMYSLTPSHKYSVKRETNSLKVPYYVKD 298

  Fly   157 PKYRNQALEIARDEIQEKIQKKGKNRMSKNDQRD 190
            ..|......:||  ::|.:::...|.:..:..|:
  Fly   299 NFYSEYQGSVAR--LEESVEEDFVNHLKHSCSRE 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7872NP_573044.1 DnaJ 31..96 CDD:278647 26/62 (42%)
CG3061NP_650328.1 DnaJ 105..>224 CDD:223560 33/119 (28%)
DnaJ 106..167 CDD:278647 26/62 (42%)
DUF1977 269..366 CDD:286411 10/64 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.