DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7872 and CG6693

DIOPT Version :9

Sequence 1:NP_573044.1 Gene:CG7872 / 32493 FlyBaseID:FBgn0030658 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001262473.1 Gene:CG6693 / 41346 FlyBaseID:FBgn0037878 Length:299 Species:Drosophila melanogaster


Alignment Length:334 Identity:66/334 - (19%)
Similarity:115/334 - (34%) Gaps:108/334 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 YCGKENCYDVLGVTRESSKSEIGKAYRQLARRYHPDLHRGAEAKAAAETQFKLVATAYEILRDEE 90
            |.|..:.|.::.:.|.:.:.|:.|||.:|:...||| ....|.||.:..:||:::..|::|.|.:
  Fly    10 YFGTRDVYKLMELARGAGEKEVKKAYHKLSLLVHPD-RVPEEQKAESTEKFKVLSKLYQVLTDTQ 73

  Fly    91 SRTDYDY--MLDNPDAYYAHYYRYYRRRVAPKVDVRVVIVVVLTIVSVIQYYSGWQRYDSAIKYF 153
            .|..||.  ::|:.|...:.                               .|.|....|.|...
  Fly    74 KRALYDEQGVIDDDDESESK-------------------------------LSSWLELWSKIFKP 107

  Fly   154 ATVPKYRNQALEIARDEIQEKIQKK----GKNRMS---------KNDQRDELERIIRRVI----- 200
            .|.....|...|....|::....||    ||..::         |.:....:::|::.:|     
  Fly   108 ITEEDINNYEKEYVESELERTDLKKAYLGGKGCINYLMNHVPFMKVEDEPRIQKIVQDMIASGEV 172

  Fly   201 --------EEKMDVKGGYAKPTLWDVLWVQLIICPYTILSFIVWHAQWFWRYTVMKQPYGREQK- 256
                    |.....|..:.|                        :|:.|....|:|:...|.|| 
  Fly   173 PEYKIFTEEPAAKRKKRHQK------------------------YAREFKEAKVIKERLKRRQKE 213

  Fly   257 ---------------LYLIRRHLGMGQHQFEAQEDKLIEEYLHLKLWKRENFVAWKAEQEEEMKK 306
                           :.|.||:  ..:..|.:..|:|:|:|.:.......:|.|:      |.||
  Fly   214 KDDQDLADNGGDLQQMILARRN--QRESNFGSLMDRLMEKYGNEDDSDTVDFSAF------EKKK 270

  Fly   307 KLAENPRYK 315
            |.::.|..|
  Fly   271 KKSKKPAAK 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7872NP_573044.1 DnaJ 31..96 CDD:278647 19/64 (30%)
CG6693NP_001262473.1 DnaJ 15..79 CDD:278647 19/64 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464443
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.