DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7872 and Csp

DIOPT Version :9

Sequence 1:NP_573044.1 Gene:CG7872 / 32493 FlyBaseID:FBgn0030658 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001287144.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster


Alignment Length:115 Identity:34/115 - (29%)
Similarity:58/115 - (50%) Gaps:23/115 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ENCYDVLGVTRESSKSEIGKAYRQLARRYHPDLHRGAEAKAAAETQFKLVATAYEILRDEESRTD 94
            ::.|::||:.:.::..:|.|.||:||.:||||  :..:...||: :||.|..|:.||.|:..|..
  Fly    16 DSLYEILGLPKTATGDDIKKTYRKLALKYHPD--KNPDNVDAAD-KFKEVNRAHSILSDQTKRNI 77

  Fly    95 YD-------YML-----DNPDAYYAHYYRYYRRRVAPKVDVRVVIVVVLT 132
            ||       |:.     :|.:||:.        ..:|.|...|:...|:|
  Fly    78 YDNYGSLGLYIAEQFGEENVNAYFV--------VTSPAVKAVVICCAVIT 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7872NP_573044.1 DnaJ 31..96 CDD:278647 23/64 (36%)
CspNP_001287144.1 DnaJ 17..>86 CDD:223560 25/71 (35%)
DnaJ 17..79 CDD:278647 23/64 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464432
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.