DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7872 and CG2790

DIOPT Version :10

Sequence 1:NP_573044.1 Gene:CG7872 / 32493 FlyBaseID:FBgn0030658 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_611986.2 Gene:CG2790 / 37992 FlyBaseID:FBgn0027599 Length:540 Species:Drosophila melanogaster


Alignment Length:242 Identity:56/242 - (23%)
Similarity:93/242 - (38%) Gaps:86/242 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 YDVLGVTRESSKSEIGKAYRQLARRYHPDLHRGAEAKAAAETQFKLVATAYEILRDEESRTDYD- 96
            |:.|.:.|.::..:|..|||::|.|:|||  :..:..|.|:.:|:|:..|||:|.|.:.|:.|| 
  Fly     5 YEELELQRNANDGDIKSAYRKMALRWHPD--KNPDRLAEAKERFQLIQQAYEVLSDPQERSWYDN 67

  Fly    97 ---YMLDNPDAYYAH-----------------------YYRYY-------------------RRR 116
               .:|...::.||.                       :||.|                   |..
  Fly    68 HREQILRGKNSDYAENCLDVFQFFTSSCYKGYGDNEHGFYRVYTDVFVQIASEDLEFMDKDDRLG 132

  Fly   117 VAPKV--------DVRVVIVVVLTIVSVIQYYSGWQRYDSAIKYFATVPKYRNQALEIARDEIQE 173
            :||..        ||            |..:|:.||.|.:...|....|   ....||....|..
  Fly   133 MAPDFGHSNSSYEDV------------VGPFYAFWQAYSTRKTYDWLCP---YDVREIKERFILR 182

  Fly   174 KIQKKGKN-----RMSKNDQ----------RDELERIIRRVIEEKMD 205
            |::|:.|.     |..:|::          ||...:..||::||:::
  Fly   183 KVEKEMKKIVQAARKERNEEVRNLVNFVRKRDPRVQAYRRMLEERVE 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7872NP_573044.1 DnaJ 31..169 CDD:440252 44/189 (23%)
DnaJ 31..96 CDD:395170 22/62 (35%)
CG2790NP_611986.2 terminal_TopJ 2..>154 CDD:468284 37/162 (23%)
PRK10767 2..>66 CDD:236757 22/62 (35%)
PRK12704 170..>272 CDD:237177 14/60 (23%)
PTZ00108 <182..437 CDD:240271 11/48 (23%)
zf-C2H2_jaz 313..337 CDD:432381
C2H2 Zn finger 315..337 CDD:275371
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.