DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7872 and CG8531

DIOPT Version :9

Sequence 1:NP_573044.1 Gene:CG7872 / 32493 FlyBaseID:FBgn0030658 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_610945.1 Gene:CG8531 / 36584 FlyBaseID:FBgn0033918 Length:545 Species:Drosophila melanogaster


Alignment Length:344 Identity:74/344 - (21%)
Similarity:120/344 - (34%) Gaps:93/344 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ENCYDVLGVTRESSKSEIGKAYRQLARRYHPDLHRGAEAKAAAETQFKLVATAYEILRDEESRTD 94
            ||.|..|.:.|:::..:|..|||:.:|.:|||.|...::|..||..|.....|||:|.|.:.|..
  Fly    14 ENYYTFLNLPRDATAEQINTAYRKQSRMFHPDKHLDPDSKKMAEIMFNRTKRAYEVLSDPQQRAI 78

  Fly    95 YD---------------YMLDNPDAYYAHYYRYYR----RRVAPKVDVRVVIVVVLTIVSVIQYY 140
            ||               :....||.....|.|..:    ||:..:.:.|..|.:.:....:...|
  Fly    79 YDSVGEKGLRTEGWEILHRTKTPDEIREEYERLAQAAAERRLQQRTNPRGNITINVNATEIFAPY 143

  Fly   141 SGWQRYDSAIKYFATVPKYRNQALEIARDEIQEKIQKKGKNRMSKNDQRDE----------LERI 195
            .     ||      .:|.....::.||: .|:..|.:|....||.|.....          ..|:
  Fly   144 D-----DS------EMPHVEIGSMSIAQ-SIEAPITRKDMIIMSGNLYSSNGNGSGGFVIAGRRL 196

  Fly   196 IR---------------------RVIEEKMDVKGGY--------AKPTLWDVLWVQL---IICPY 228
            :.                     |.:.:|:.:.||.        ..|.|:..|.|||   .:...
  Fly   197 LNKGWIELCAGAGNGFLLGLKGGRTLSQKLTLNGGTNLNFRDQGVIPALFSTLAVQLDKHTMGSL 261

  Fly   229 TI-------LSFIVWHAQWFWRYTVMKQPYGREQKLYLIRRHLGMGQHQFEAQEDKLIEEYLHLK 286
            |:       :|..:.|:         |:.|.....|.:...|:..|.    :...|::|..|.||
  Fly   262 TLNAGSQSSMSTQIDHS---------KETYSLSSSLVIGTPHVYFGL----SYTRKMMENELKLK 313

  Fly   287 LWKRENFVAWKAEQEEEMK 305
            |..:.....:..|...|.|
  Fly   314 LAAKVGTFGFMGEYGVEKK 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7872NP_573044.1 DnaJ 31..96 CDD:278647 23/64 (36%)
CG8531NP_610945.1 DnaJ 15..>91 CDD:223560 25/75 (33%)
DnaJ 15..80 CDD:278647 23/64 (36%)
DUF3395 409..538 CDD:288708
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464398
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.