DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7872 and Tpr2

DIOPT Version :10

Sequence 1:NP_573044.1 Gene:CG7872 / 32493 FlyBaseID:FBgn0030658 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_523584.1 Gene:Tpr2 / 34984 FlyBaseID:FBgn0032586 Length:508 Species:Drosophila melanogaster


Alignment Length:95 Identity:31/95 - (32%)
Similarity:50/95 - (52%) Gaps:11/95 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KENCYDVLGVTRESSKSEIGKAYRQLARRYHPDLH--RGAEAKAAAETQFKLVATAYEILRDEES 91
            :::.|.:||:.|.:|..||.||||:.|..:|||.|  ..||.:...|.:||.|..||.||.|...
  Fly   400 RKDYYKILGIGRNASDDEIKKAYRKKALVHHPDRHANSSAEERKEEELKFKEVGEAYAILSDAHK 464

  Fly    92 RTDYDYMLD---------NPDAYYAHYYRY 112
            ::.||...|         :|:..:..::::
  Fly   465 KSRYDSGQDIEEQEQADFDPNQMFRTFFQF 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7872NP_573044.1 DnaJ 31..169 CDD:440252 31/93 (33%)
DnaJ 31..96 CDD:395170 27/66 (41%)
Tpr2NP_523584.1 TPR repeat 49..77 CDD:276809
TPR 55..>258 CDD:440225
TPR repeat 82..112 CDD:276809
TPR 190..419 CDD:440225 6/18 (33%)
TPR repeat 201..225 CDD:276809
TPR repeat 231..259 CDD:276809
TPR repeat 310..344 CDD:276809
TPR repeat 349..377 CDD:276809
DnaJ_bact 402..>503 CDD:274090 31/93 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.