DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7872 and l(3)80Fg

DIOPT Version :9

Sequence 1:NP_573044.1 Gene:CG7872 / 32493 FlyBaseID:FBgn0030658 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001015187.2 Gene:l(3)80Fg / 3354941 FlyBaseID:FBgn0287183 Length:780 Species:Drosophila melanogaster


Alignment Length:354 Identity:73/354 - (20%)
Similarity:131/354 - (37%) Gaps:118/354 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVLLALLPTMALGLLEGLYCGKENCYDVLGVTRESSKSEIGKAYRQLARRYHPDLHR---GAEAK 69
            :.:|.|..|..:.:...|    .:.|.:||:.::::..||.:||::||:::|||..:   |||  
  Fly    11 ITILVLCTTSYIHVCSSL----NDPYAILGINKKATTYEIREAYKELAKKWHPDKVKNDYGAE-- 69

  Fly    70 AAAETQFKLVATAYEILRDEESRTDYD-YMLDNPDAYY---AHYYRYYRR------------RVA 118
                 :|..:..|||||.|.:.|..:| |.:.:.::.|   .|.|..|.|            |..
  Fly    70 -----KFIQIKLAYEILADLDRRRIFDRYGVSDINSQYFQKKHDYSEYNRFTLNQNDDDFGQRFD 129

  Fly   119 PKVDV--------------RVVIVVVLTIVSVIQYYSGWQRYDSAIKYFATVPKYRNQALEIARD 169
            .|.|:              ::::......|.|:.:|:.|     ..|....|..::         
  Fly   130 IKQDIAFYQKLSITENYFEKMILSKNAKKVHVVMFYNDW-----CFKCTRIVDAFK--------- 180

  Fly   170 EIQEKIQKKGKNRMSKNDQRDELERIIRRVIEEKMDVKGGYAKPTLWDVLWVQLIICPYTILSFI 234
            :|.|.:|..|.|..:.|...:  |.:.|:.        |....|        ||::    ||   
  Fly   181 KILELLQPIGINFATVNAVHE--ESVFRKC--------GAREVP--------QLVL----IL--- 220

  Fly   235 VWHAQWFWRYTVMKQPYGREQKLYLIRRHLGMGQHQFEAQEDKLIEEYLHLKL----WKR---EN 292
                               :.:.:|.|      .|.|..|:   :.|::..|:    :||   :|
  Fly   221 -------------------DNQYFLYR------DHSFTPQK---VVEFIRKKIPFNVFKRIEHDN 257

  Fly   293 FVAWKAEQEEEMKKKLAENPRYKAYRRYM 321
            |..:.....:...:.|...||.....||:
  Fly   258 FNDFLGGWSDNRARALIFEPRSLTRLRYL 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7872NP_573044.1 DnaJ 31..96 CDD:278647 23/67 (34%)
l(3)80FgNP_001015187.2 DnaJ 30..>94 CDD:223560 24/70 (34%)
DnaJ 30..91 CDD:278647 23/67 (34%)
TRX_DnaJ 134..244 CDD:239261 26/176 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464407
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.