DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7872 and CG7556

DIOPT Version :9

Sequence 1:NP_573044.1 Gene:CG7872 / 32493 FlyBaseID:FBgn0030658 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001285427.1 Gene:CG7556 / 32902 FlyBaseID:FBgn0030990 Length:522 Species:Drosophila melanogaster


Alignment Length:331 Identity:80/331 - (24%)
Similarity:132/331 - (39%) Gaps:88/331 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVLLALLPTMALG-------------LLEGLYCGKENCYDVLGVTRESSKSEIGKAYRQLARRYH 59
            |.|..||...|.|             |:|.:   ..|.|:.:|:.:.::.:|:.:|:|.|:...|
  Fly     7 LTLAGLLLLCATGASAWHSEELEIFDLVEEV---NRNFYEFMGINQTATGAEVKRAFRTLSIVLH 68

  Fly    60 PDLHRGAEAKAAAETQFKLVATAYEILRDEESRTDYDYMLDN--PDAYYAHYYRYYRRRVAPKVD 122
            ||.:...:    |..||:.:.:.||:|:|...|..||.:|..  |:...|.|  ||||  ..|:.
  Fly    69 PDKNPAED----ANIQFRNLVSIYEVLKDPSRREKYDRVLKEGMPNWKSALY--YYRR--MRKIG 125

  Fly   123 VRVVIVVVLTIVSVIQYYSGWQRY----DSAIKYFATVPKYRNQALEIARDEIQEKIQKKGKNRM 183
            :.....::..|.:|.||...|..|    .:|.:.|.|..|               |:|||.||  
  Fly   126 LYEGAFILFLITTVGQYLFAWAAYLEKKYTAEQVFGTKLK---------------KLQKKNKN-- 173

  Fly   184 SKNDQRDELERIIRRVIEEKMDVKGGYAKPTLWDVLWVQLIIC----PYTILSFIVWHAQWFWRY 244
                  .:::.|:..:           ..|:|.:.|.:|:.:.    |.||       ...|.:.
  Fly   174 ------IDMDVILSEI-----------PMPSLLNTLPIQIPLALWNLPRTI-------KNGFSKA 214

  Fly   245 TVMKQ--PYGREQKLYLIRRHLGMGQHQFEAQEDKLIEEYLHLKLWKRENFVAWKAEQEEEMKKK 307
            ..:|:  ...|.|:|..:||     |.:.|.:    .||...|:...:||.  .|.:|..:..:|
  Fly   215 NELKELALEKRRQELEAVRR-----QEELERE----AEEQARLRKEHKENL--RKRKQNSKAPEK 268

  Fly   308 LAENPR 313
            ..|..|
  Fly   269 TEEELR 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7872NP_573044.1 DnaJ 31..96 CDD:278647 18/64 (28%)
CG7556NP_001285427.1 DnaJ 40..101 CDD:278647 18/64 (28%)
SANT 301..>341 CDD:197842
SANT 304..341 CDD:238096
SANT 399..447 CDD:197842
SANT 400..447 CDD:238096
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464388
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.