Sequence 1: | NP_573044.1 | Gene: | CG7872 / 32493 | FlyBaseID: | FBgn0030658 | Length: | 333 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006254608.1 | Gene: | Dnajc18 / 291677 | RGDID: | 1310237 | Length: | 357 | Species: | Rattus norvegicus |
Alignment Length: | 242 | Identity: | 59/242 - (24%) |
---|---|---|---|
Similarity: | 95/242 - (39%) | Gaps: | 78/242 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 31 NCYDVLGVTRESSKSEIGKAYRQLARRYHPDLHRGAEAKAAAETQFKLVATAYEILRDEESRTDY 95
Fly 96 D------YMLDNPDAYYAHYYR------------------------------------YYRRR-- 116
Fly 117 ----VAPKVD-----------VRVVIVVVLTIVSVIQY-------YSGWQRYDSAIKYFATVPKY 159
Fly 160 RNQALEIAR--DEIQEKIQKKGKNR-MSKNDQRDELERIIRRVIEEK 203 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7872 | NP_573044.1 | DnaJ | 31..96 | CDD:278647 | 22/64 (34%) |
Dnajc18 | XP_006254608.1 | DnaJ | 82..143 | CDD:278647 | 22/64 (34%) |
DUF1977 | 250..349 | CDD:286411 | 16/70 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |