DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7872 and Dnajc18

DIOPT Version :9

Sequence 1:NP_573044.1 Gene:CG7872 / 32493 FlyBaseID:FBgn0030658 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_006254608.1 Gene:Dnajc18 / 291677 RGDID:1310237 Length:357 Species:Rattus norvegicus


Alignment Length:242 Identity:59/242 - (24%)
Similarity:95/242 - (39%) Gaps:78/242 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 NCYDVLGVTRESSKSEIGKAYRQLARRYHPDLHRGAEAKAAAETQFKLVATAYEILRDEESRTDY 95
            |.||:|||:..:|..|:.|||::||.::|||    ......|...||.:..|:.:|.:.:.|..|
  Rat    82 NYYDILGVSHNASDEELKKAYKKLALKFHPD----KNCAPGATDAFKAIGNAFAVLSNPDKRLRY 142

  Fly    96 D------YMLDNPDAYYAHYYR------------------------------------YYRRR-- 116
            |      ..|..|.|...||||                                    |||||  
  Rat   143 DEYGDEQVTLTAPRARPYHYYRDVEADISPEELFNVFFGGHFPSGNIHMFSNVTDDSHYYRRRHR 207

  Fly   117 ----VAPKVD-----------VRVVIVVVLTIVSVIQY-------YSGWQRYDSAIKYFATVPKY 159
                .|.|.:           |:::.|:::..:|||..       ||.:  |.|.:.|  |:.: 
  Rat   208 HERTQAHKREEDKSQTPYSAFVQLLPVLLIVTISVITQLLAANPPYSLF--YKSTLGY--TISR- 267

  Fly   160 RNQALEIAR--DEIQEKIQKKGKNR-MSKNDQRDELERIIRRVIEEK 203
            ..|.|::..  |:..:|..:....| :.|..::|.::.|.....:||
  Rat   268 ETQNLQVPYFVDKNFDKAYRGASLRDLEKTIEKDYIDYIQTSCWKEK 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7872NP_573044.1 DnaJ 31..96 CDD:278647 22/64 (34%)
Dnajc18XP_006254608.1 DnaJ 82..143 CDD:278647 22/64 (34%)
DUF1977 250..349 CDD:286411 16/70 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.