DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7872 and DNAJC18

DIOPT Version :9

Sequence 1:NP_573044.1 Gene:CG7872 / 32493 FlyBaseID:FBgn0030658 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_689899.1 Gene:DNAJC18 / 202052 HGNCID:28429 Length:358 Species:Homo sapiens


Alignment Length:314 Identity:66/314 - (21%)
Similarity:119/314 - (37%) Gaps:96/314 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 NCYDVLGVTRESSKSEIGKAYRQLARRYHPDLHRGAEAKAAAETQFKLVATAYEILRDEESRTDY 95
            |.|::|||:|::|..|:.||||:||.::|||    ......|...||.:..|:.:|.:.:.|..|
Human    82 NYYEILGVSRDASDEELKKAYRKLALKFHPD----KNCAPGATDAFKAIGNAFAVLSNPDKRLRY 142

  Fly    96 DYMLDN------PDAYYAHYYRYYRRRVAPKVDVRVVIVVVLTIVSVIQYYSGWQRYDSAIKYFA 154
            |...|.      |.|...:|||.:...:.|:              .:...:.|.......|..|:
Human   143 DEYGDEQVTFTAPRARPYNYYRDFEADITPE--------------ELFNVFFGGHFPTGNIHMFS 193

  Fly   155 TVP--------KYRNQALEIARDEIQEKIQKKGKNRMSKNDQRDELERIIRRVIEEKMDVKGGYA 211
            .|.        ::|::..:..::|.:||.|             ......|:.:            
Human   194 NVTDDTYYYRRRHRHERTQTQKEEEEEKPQ-------------TTYSAFIQLL------------ 233

  Fly   212 KPTLWDVL---WVQLIIC--PYTILSFIVWHAQWFWR----YTVMKQ------PYGREQKLYLIR 261
             |.|..|:   ..||:..  ||::          |::    ||:.::      ||..::.  ..:
Human   234 -PVLVIVIISVITQLLATNPPYSL----------FYKSTLGYTISRETQNLQVPYFVDKN--FDK 285

  Fly   262 RHLGMGQHQFEAQEDKLIEEYLHLKLWKRENFVAWKAE--------QEEEMKKK 307
            .:.|...|..|...:|...:|:....||.:.   .|:|        ::|.:|:|
Human   286 AYRGASLHDLEKTIEKDYIDYIQTSCWKEKQ---QKSELTNLAGLYRDERLKQK 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7872NP_573044.1 DnaJ 31..96 CDD:278647 23/64 (36%)
DNAJC18NP_689899.1 DnaJ 82..143 CDD:278647 23/64 (36%)
DUF1977 250..350 CDD:286411 19/102 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.