DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7872 and C47A4.1

DIOPT Version :9

Sequence 1:NP_573044.1 Gene:CG7872 / 32493 FlyBaseID:FBgn0030658 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_502648.2 Gene:C47A4.1 / 183525 WormBaseID:WBGene00008122 Length:157 Species:Caenorhabditis elegans


Alignment Length:160 Identity:59/160 - (36%)
Similarity:100/160 - (62%) Gaps:6/160 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 IQKKGKNRMSKNDQRDELERIIRRVIEEKMDVKGGYAKPTLWDVLWVQLIICPYTILSFIVWHAQ 239
            :.:.||.:.:|....||   :|:::|.:.:||.|||.:.:::|.|....||.|.||..:|.|.|.
 Worm     1 MDRNGKLKKNKGVDNDE---VIKQIIIDNLDVTGGYKRESIYDTLAWHTIIFPLTIFRYIKWTAL 62

  Fly   240 WFWRYTVMKQPYGREQKLYLIRRHLGMGQHQFEAQ-EDKLIEEYLHLKLWKRENFVAWKAEQEEE 303
            |:||:.:.|:.|..:.||||||:::|:.|.:|:.: .|:.|::....:.|.:.|...||||::..
 Worm    63 WYWRFAIQKEEYDDDAKLYLIRKYIGVSQMEFDQKYTDEDIDDLFERECWLKTNCATWKAERDAA 127

  Fly   304 MKKKLAENPRYKAYRRYMKNHGPGRITFED 333
            .::|:|::.|||.|:|||||  .|.|:|.|
 Worm   128 EQEKMAQSGRYKRYKRYMKN--AGTISFVD 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7872NP_573044.1 DnaJ 31..96 CDD:278647
C47A4.1NP_502648.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164708
Domainoid 1 1.000 190 1.000 Domainoid score I1919
eggNOG 1 0.900 - - E2759_KOG0722
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H37883
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1332758at2759
OrthoFinder 1 1.000 - - FOG0005688
OrthoInspector 1 1.000 - - otm14255
orthoMCL 1 0.900 - - OOG6_105648
Panther 1 1.100 - - LDO PTHR44176
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.710

Return to query results.
Submit another query.