DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7872 and dnj-7

DIOPT Version :10

Sequence 1:NP_573044.1 Gene:CG7872 / 32493 FlyBaseID:FBgn0030658 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_509209.1 Gene:dnj-7 / 180983 WormBaseID:WBGene00001025 Length:491 Species:Caenorhabditis elegans


Alignment Length:92 Identity:40/92 - (43%)
Similarity:55/92 - (59%) Gaps:10/92 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 EGL--------YCGKENCYDVLGVTRESSKSEIGKAYRQLARRYHPDLHRGAEAKAAAETQFKLV 79
            |||        ..||.:.|.:|||.|.:||.||.||||:||:::|||.....|.|..||.:|..:
 Worm   363 EGLEHAKRLKTQAGKRDYYKILGVKRNASKREITKAYRKLAQKWHPDNFSDEEEKKKAEKKFIDI 427

  Fly    80 ATAYEILRDEESRTDYDYMLD--NPDA 104
            |.|.|:|:|||.|..:|..:|  :|:|
 Worm   428 AAAKEVLQDEEKRRQFDQGVDPLDPEA 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7872NP_573044.1 DnaJ 31..169 CDD:440252 35/76 (46%)
DnaJ 31..96 CDD:395170 31/64 (48%)
dnj-7NP_509209.1 TPR 29..>198 CDD:440225
TPR repeat 29..54 CDD:276809
PEP_TPR_lipo 58..>410 CDD:274350 22/46 (48%)
TPR repeat 59..89 CDD:276809
TPR repeat 94..121 CDD:276809
TPR repeat 140..168 CDD:276809
TPR repeat 173..203 CDD:276809
TPR repeat 208..236 CDD:276809
TPR repeat 324..354 CDD:276809
DnaJ 379..444 CDD:395170 31/64 (48%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.