DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7872 and dnj-28

DIOPT Version :10

Sequence 1:NP_573044.1 Gene:CG7872 / 32493 FlyBaseID:FBgn0030658 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_491084.1 Gene:dnj-28 / 171870 WormBaseID:WBGene00001046 Length:494 Species:Caenorhabditis elegans


Alignment Length:77 Identity:32/77 - (41%)
Similarity:49/77 - (63%) Gaps:0/77 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GKENCYDVLGVTRESSKSEIGKAYRQLARRYHPDLHRGAEAKAAAETQFKLVATAYEILRDEESR 92
            ||.:.|.:|||.|.::|.||.||||::|:::|||..:..:.|..||.:|..:|.|.|:|.:||.|
 Worm   377 GKRDYYKILGVRRNANKREITKAYRKMAQKWHPDNFQDEKEKKKAEKKFIDIAAAKEVLSNEEKR 441

  Fly    93 TDYDYMLDNPDA 104
            ..:|...|..|:
 Worm   442 RAFDNGQDPLDS 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7872NP_573044.1 DnaJ 31..169 CDD:440252 30/74 (41%)
DnaJ 31..96 CDD:395170 27/64 (42%)
dnj-28NP_491084.1 NlpI <23..>122 CDD:443815
TPR repeat 28..52 CDD:276809
TPR repeat 57..87 CDD:276809
TPR repeat 92..116 CDD:276809
LapB 167..>363 CDD:442196
TPR repeat 175..203 CDD:276809
TPR repeat 208..238 CDD:276809
TPR repeat 291..321 CDD:276809
TPR repeat 326..352 CDD:276809
DnaJ 380..445 CDD:395170 27/64 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.