DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7872 and dnajb9

DIOPT Version :9

Sequence 1:NP_573044.1 Gene:CG7872 / 32493 FlyBaseID:FBgn0030658 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001116196.1 Gene:dnajb9 / 100038131 XenbaseID:XB-GENE-493656 Length:221 Species:Xenopus tropicalis


Alignment Length:101 Identity:33/101 - (32%)
Similarity:57/101 - (56%) Gaps:14/101 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LLEGLYCGKENCYDVLGVTRESSKSEIGKAYRQLARRYHPDLHRGAEAKAAAETQFKLVATAYEI 85
            |:..:...|:..||:|||.:.:|:.:|.||:.:||.:||||.::..:    ||.:|:.:|.|||.
 Frog    16 LISEIILAKKTYYDILGVPKNASERQIKKAFHKLAMKYHPDKNKSPD----AEAKFREIAEAYET 76

  Fly    86 LRDEESRTDYDYMLDNPDAYY--------AHYYRYY 113
            |.||..|.:||..  ..||:.        .|:::::
 Frog    77 LSDESKRKEYDQF--GHDAFANAGKGSSDQHFHKHF 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7872NP_573044.1 DnaJ 31..96 CDD:278647 26/64 (41%)
dnajb9NP_001116196.1 DnaJ 23..>193 CDD:223560 32/94 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.